SecReT4
Protein ID: 148548153
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2943
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3324670..3325071 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA5W4L1
KEGG IDppf:Pput_2943
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.7e-46, Aligned region: 10..128
Protein Sequence: 133 a.a.     [Download]
>gi|148548153|ref|YP_001268255.1| unnamed protein product [Pseudomonas putida F1]
MSDAPATLPDGTLTFLPERLNRDPAVLRGLTNDEMWVALIIGAGLGVILGAPLAVATVSIATLPTCMFIC
MALVLLGGGKLLRRAKRARPETWLYRRLQWHLAVHWSVGTHQLILHSGPWTVRRTRRHARATP
 
Nucleotide Sequence: 402 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3324670-3325071 Pseudomonas putida F1 chromosome, complete genome
ATGTCCGACGCCCCTGCCACCCTGCCTGACGGCACGCTGACCTTTCTTCCTGAGCGCCTCAACCGTGACC
CGGCCGTTCTTCGTGGGCTCACCAACGACGAGATGTGGGTCGCGCTGATCATCGGCGCAGGGCTAGGTGT
GATTCTCGGCGCGCCGCTGGCCGTGGCCACCGTCTCCATCGCGACCCTCCCCACCTGCATGTTCATCTGC
ATGGCGCTGGTGCTGCTCGGTGGCGGCAAGCTACTGCGCCGAGCCAAGCGCGCCCGCCCCGAAACCTGGC
TTTATCGGCGCCTGCAATGGCATCTGGCAGTGCACTGGAGTGTCGGCACTCACCAGTTGATCCTGCACTC
GGGGCCTTGGACAGTGCGCCGCACGCGTCGACATGCGAGGGCGACGCCATGA
 Primer design