SecReT4
Protein ID: 148548154
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2944
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3325068..3325709 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDA5W4L2
KEGG IDppf:Pput_2944
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 3.7e-88, Aligned region: 5..206
Protein Sequence: 213 a.a.     [Download]
>gi|148548154|ref|YP_001268256.1| unnamed protein product [Pseudomonas putida F1]
MSRFRNKVDAQQAHIFSLRLAVSILALLSCGLWYGWQSAPSELTIHVPPDLRSGSTRKWWDVPPENIYAF
ALYIFGQLNRWPTDGEVDYHRAIFALQPYLTPACKTFFDGDFEYRKAAGELRGRVRGVYEVLGRGYSDDP
DLRVKQLDRHSWLVKLDLNADEYYAAEPVKRVVVRYPLRVVRFDVDPEHNKWGLALDCYEGTPQKLTLPG
GAG
 
Nucleotide Sequence: 642 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3325068-3325709 Pseudomonas putida F1 chromosome, complete genome
ATGAGCCGCTTTCGCAACAAGGTGGATGCGCAGCAGGCGCATATCTTCAGTCTGCGTCTGGCCGTTTCGA
TCCTGGCACTGCTGTCCTGCGGGCTTTGGTACGGCTGGCAGTCCGCGCCTTCCGAGCTGACCATTCACGT
GCCGCCCGATCTGCGCTCTGGCAGTACGCGCAAGTGGTGGGATGTACCCCCGGAAAACATCTACGCCTTC
GCGCTGTACATCTTCGGCCAGCTCAACCGCTGGCCCACCGACGGCGAGGTCGACTACCACCGCGCCATCT
TTGCCCTTCAACCCTACCTGACCCCGGCGTGCAAGACCTTCTTCGACGGAGACTTCGAGTACCGCAAGGC
CGCCGGCGAACTGCGCGGTCGGGTGCGCGGCGTATACGAGGTGCTGGGCCGCGGCTACAGCGACGACCCC
GACCTGCGGGTGAAGCAGCTGGATAGGCACAGCTGGCTGGTGAAGCTCGACCTCAACGCCGACGAGTACT
ACGCCGCTGAGCCGGTGAAGCGCGTGGTGGTGCGCTATCCGCTACGGGTGGTGCGCTTCGACGTCGATCC
CGAGCACAACAAGTGGGGCTTGGCCCTGGACTGCTACGAAGGCACGCCGCAGAAGCTGACGCTGCCAGGA
GGTGCGGGATGA
 Primer design