SecReT4
Protein ID: 148548155
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2945
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3325706..3326512 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDA5W4L3
KEGG IDppf:Pput_2945
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 2e-101, Aligned region: 2..256
Protein Sequence: 268 a.a.     [Download]
>gi|148548155|ref|YP_001268257.1| unnamed protein product [Pseudomonas putida F1]
MMRVLIMMLAVAAGWCSAVGAVEVKYWDRLPLAVPLTVGQERILMLDEDVRVGVPGTIAGKLRVQSVGGT
VYLRAAEALPPTRLQLQSVKSGDIILIDIEALEGSEALEPVKIVAQASAPDVEAAKDAAPAATPVPVVLT
RYAAQNLYAPLRTVGPLPGVRRVPLSDAVAFSSLLPTERVSIKALAAWRLGDYWVTAVKIVNRGPGKITL
DPRHLQATLYAATFQHADLGLAGTPEDTTVAYLVTRGGDLRHALLLPPPKPEADAHES
 
Nucleotide Sequence: 807 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3325706-3326512 Pseudomonas putida F1 chromosome, complete genome
ATGATGCGAGTCTTGATCATGATGCTGGCGGTAGCCGCAGGCTGGTGTTCTGCAGTCGGTGCGGTCGAGG
TCAAATACTGGGATCGCCTGCCGCTGGCCGTTCCACTCACGGTGGGCCAAGAGCGCATCCTGATGCTGGA
TGAGGATGTTCGCGTGGGGGTACCGGGCACGATCGCCGGCAAGCTGCGTGTGCAGTCCGTCGGCGGCACC
GTGTATCTGCGCGCCGCGGAAGCCCTTCCCCCTACCCGGCTGCAACTGCAGTCGGTGAAGTCAGGCGACA
TCATCCTGATCGACATCGAAGCGCTTGAGGGCAGTGAGGCCCTGGAGCCGGTCAAGATCGTGGCCCAGGC
TTCGGCACCGGACGTGGAAGCGGCGAAAGATGCAGCACCTGCCGCGACGCCGGTACCGGTGGTGCTCACC
CGCTATGCGGCGCAGAACCTCTATGCGCCCCTGCGCACCGTGGGACCGCTGCCCGGTGTGCGACGGGTGC
CGCTGAGCGACGCCGTTGCGTTCAGTTCGTTGCTGCCCACCGAGCGGGTCTCGATCAAGGCACTCGCCGC
CTGGCGGCTGGGCGACTACTGGGTGACCGCGGTGAAGATCGTGAACCGTGGCCCCGGCAAGATCACGCTT
GACCCGCGTCACCTGCAGGCCACGCTGTACGCCGCAACCTTCCAGCACGCGGACCTCGGCCTTGCCGGTA
CGCCTGAAGACACCACCGTGGCCTATCTCGTCACCCGCGGCGGCGACCTGAGGCATGCGCTGCTGTTGCC
CCCGCCAAAGCCGGAGGCTGACGCTCATGAAAGCTAA
 Primer design