SecReT4
Protein ID: 148548156
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2946
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3326502..3328010 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDA5W4L4
KEGG IDppf:Pput_2946
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 502 a.a.     [Download]
>gi|148548156|ref|YP_001268258.1| unnamed protein product [Pseudomonas putida F1]
MKANGLLKWLVPAVLLGIVLIIIKSWVTAPDGQPTHDPENATLSAEQAKALGIAGDTPRDTVATLIGQVK
AMRSEMQTLKKGNDTLQTENNRLRTREGNTDTRIQSTLSSVTQQVTEQRQQANDARQKAEQQHRETQGLL
SRLKDQLTGKPAAKSDVPAGFGLEQGDEQQLAGAQAPADAVQWIEPSNARAGQEDTDKADGPLSSLTSKF
KDLHALDNNAIDRGQDRLRAVAKGERDLENAQDRTEGARPVYTIPENSTLMGSIAMTALIGRVPVDGTVN
DPYPFKVLVGPDNLTANGIDLPDVVGAVMSGTAAGDWTLSCVRGQVESITFVFSDGTVRTVPQPQKVVSR
NRSSNQTSDTEKIRGGLGYISDPYGIPCISGERRSNAQQYLGSQSLITAAGAGFAAALGSEQTNTSFINS
ASGSLGLSQNSGNSALNSVISGGIGDIREWINKLYGEAFAAIYVPPGAKVALHLDHEISIDYEPKGRRVN
HESPSVSVLDLD
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3326502-3328010 Pseudomonas putida F1 chromosome, complete genome
ATGAAAGCTAACGGCCTGCTGAAATGGTTGGTGCCTGCGGTCCTGCTGGGCATCGTGCTGATCATCATCA
AGTCCTGGGTGACCGCCCCGGATGGCCAGCCAACTCACGATCCGGAGAATGCCACGCTCAGCGCGGAACA
GGCCAAAGCCTTGGGCATCGCCGGCGACACCCCGCGCGACACCGTGGCCACGCTGATCGGCCAGGTAAAA
GCGATGCGCAGCGAAATGCAGACGTTGAAGAAAGGCAACGATACGCTGCAGACCGAAAACAACCGGCTGC
GCACGCGCGAAGGAAACACCGACACGCGCATCCAGAGCACGCTGAGCAGCGTCACCCAACAGGTCACCGA
GCAGCGCCAGCAGGCCAACGATGCTCGGCAGAAAGCTGAGCAGCAACACCGCGAGACCCAGGGACTGCTC
TCCAGGCTCAAGGACCAGCTCACCGGCAAGCCAGCCGCGAAGTCAGATGTTCCCGCAGGCTTCGGTCTTG
AACAAGGCGACGAGCAGCAATTGGCAGGGGCTCAAGCGCCGGCAGATGCGGTGCAGTGGATCGAACCGTC
GAATGCACGCGCTGGGCAAGAGGATACCGACAAAGCTGATGGTCCCCTGTCGTCGTTGACCTCTAAGTTC
AAGGACCTGCACGCCCTGGATAACAACGCCATTGATCGTGGCCAGGACCGCCTGCGTGCCGTCGCCAAAG
GCGAGCGTGATCTGGAGAACGCCCAGGACCGTACCGAAGGTGCCCGTCCCGTCTACACCATCCCCGAGAA
TTCGACGCTGATGGGCTCGATCGCCATGACCGCGCTCATTGGCCGGGTGCCGGTGGACGGCACAGTGAAC
GATCCCTATCCGTTCAAGGTGCTGGTGGGGCCAGACAACCTCACTGCCAACGGCATCGACCTGCCGGACG
TGGTCGGCGCGGTCATGAGCGGGACTGCCGCCGGTGACTGGACGTTGTCCTGCGTGCGCGGCCAGGTCGA
GTCGATCACCTTCGTCTTCAGCGACGGTACCGTCCGCACGGTGCCGCAGCCGCAGAAGGTCGTCAGCCGC
AATCGCAGTAGTAATCAAACCTCGGACACCGAGAAGATCCGCGGCGGCCTGGGCTACATCTCCGACCCGT
ACGGCATTCCGTGCATTTCCGGCGAGCGCCGCTCCAACGCCCAGCAGTACCTGGGCAGCCAGAGCCTGAT
CACCGCAGCCGGCGCCGGCTTTGCCGCGGCCTTGGGCAGCGAGCAGACCAACACCTCATTCATCAATTCG
GCCAGCGGCAGCCTGGGCCTGTCCCAGAACAGCGGCAACAGCGCGCTCAACTCAGTGATCAGCGGGGGCA
TTGGCGACATTCGTGAGTGGATCAACAAGCTCTACGGTGAAGCCTTCGCCGCCATCTACGTGCCACCCGG
GGCCAAGGTGGCTTTGCACCTGGACCACGAAATCAGCATCGACTACGAACCTAAAGGCCGGAGAGTGAAC
CATGAAAGCCCATCCGTCTCGGTACTGGATCTGGATTAG
 Primer design