SecReT4
Protein ID: 148548157
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2947
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3327973..3328392 [+]
Producthypothetical protein
Component typeTfc15
UniProt IDA5W4L5
KEGG IDppf:Pput_2947
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 139 a.a.     [Download]
>gi|148548157|ref|YP_001268259.1| unnamed protein product [Pseudomonas putida F1]
MKAHPSRYWIWISLLLGLHLAGCSTSKEEMLPHGDHTMLDIWNGGGSVGTQQQLLEARGELRRPVQDPER
LINAQSAYTRTAANEIRAQFPRLPNPDLVMYVYPHLAGTQQTPVPGYSTVFPLYEKVQYALPGERLDDL
 
Nucleotide Sequence: 420 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3327973-3328392 Pseudomonas putida F1 chromosome, complete genome
ATGAAAGCCCATCCGTCTCGGTACTGGATCTGGATTAGCCTGCTGCTCGGCCTGCACCTGGCCGGCTGCT
CCACCAGCAAGGAAGAAATGCTGCCCCACGGCGATCACACCATGCTGGATATCTGGAACGGCGGTGGCTC
GGTCGGTACGCAGCAACAGCTGTTGGAGGCGCGTGGCGAACTGCGTCGCCCGGTGCAGGACCCCGAGCGC
CTGATCAACGCCCAGAGCGCCTACACTCGCACCGCCGCGAACGAGATCCGTGCCCAGTTCCCACGCCTGC
CCAATCCAGACCTGGTCATGTACGTCTACCCGCATCTGGCAGGTACCCAACAAACGCCGGTGCCTGGCTA
CTCGACCGTGTTCCCGTTGTACGAGAAGGTCCAGTACGCCCTGCCCGGCGAGCGCCTGGACGATCTGTGA
 Primer design