SecReT4
Protein ID: 148548158
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2948
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3328392..3331133 [+]
ProductType IV secretory pathway VirB4 components-like protein
Component typeTfc16
UniProt IDA5W4L6
KEGG IDppf:Pput_2948
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 8.9e-73, Aligned region: 34..307
AAA_10 [PF12846], Evalue: 8.8e-47, Aligned region: 500..833
Protein Sequence: 913 a.a.     [Download]
>gi|148548158|ref|YP_001268260.1| unnamed protein product [Pseudomonas putida F1]
MADDASRDPSRWKPWRAAQRRRATLADETAQYAHNPSFTDHLPWVEYLEEGQCFLLDDNRSVGAVFELQP
IGTEGREPEWLMAARDALEDALQDSFDELDQAPWVVQFFCQDDSDFAPYLERLERYIAPRARGRPFTEAF
LASMRRHLEAVGKPGGLFDDHVVSHLPWRGSNRRIRLVVYRWLGEQADEDGQSPVQLLNRTCDRLVASLQ
ACGVSPRRLTGRDFYAWLLPWFNPAPALTGESPAAFYRRVPYPEVDDGEELPLPFDHDFAERLFFQEPRS
NSEQGLWYFDQQPHAVMVVDKLRRPPHIGQLTGETRKGEALNALFDQLPEQSVMSLTLVITPQDVLEEQL
NRLARKAIGENLASTQTRQDVEEARALIGRQHKLYRGTLALYLRGADEQQLRQRSVQAANVLLGAGLQPV
REGDEVAACNSYLRWLPMVYNPARDTRNWYTRLLFAQHVANLLPLWGRSIGTGNPGITFFNRGGAPLSFD
PLSRFDRSMNGHLLLFGPTGAGKSATLVSILMQVMAVYRPRLFIVEAGNSFGLQGDYFATLGLTVNKVQL
KPGSDVSLAPFAHARRLIEHPDQVASLSTEELDEAAPDSGEQRDVLGELEITARLMITGGEAKEEARLTR
ADRSLIRECILDAARHCATTEQQVLTRHVRDALRKVASDTHLPDKRRERAQEMAESIDLFCQGFEGALFD
RAGTPWPESDVTIVDLATYAREGYEAQMSISYISLMNTVNNIAERDQYLGRPIIMVTDEGHIITKNPLLA
PFVVKGTKMWRKLGAWFWLATQNMADLPDAAQTMLNMIEWWICLNMPPAEIEEIARFKKLTPAQKVLLLS
ASKASGKYTEGVVLSKNLETLFRAVPPSLYLALAMTEPEEKAQRWRLMEEHQQPELEAALQVAAEIDRLR
GMS
 
Nucleotide Sequence: 2742 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3328392-3331133 Pseudomonas putida F1 chromosome, complete genome
ATGGCTGATGACGCGAGTCGCGATCCGTCCCGCTGGAAGCCCTGGCGCGCGGCACAGCGCCGGCGCGCCA
CCCTGGCCGACGAAACCGCCCAGTACGCGCACAACCCCAGCTTCACCGACCACCTGCCCTGGGTCGAGTA
TCTGGAAGAGGGACAGTGCTTTCTGCTTGATGACAACCGTTCTGTGGGTGCCGTATTCGAGCTGCAACCG
ATCGGCACGGAGGGTCGCGAGCCCGAATGGTTGATGGCCGCACGCGACGCCCTGGAAGATGCGCTGCAGG
ACAGCTTCGACGAGCTCGATCAGGCGCCCTGGGTGGTGCAGTTCTTCTGCCAGGACGACAGTGATTTTGC
CCCGTACCTTGAACGCCTGGAGCGCTACATCGCGCCGCGCGCGCGAGGTAGGCCGTTCACCGAGGCCTTC
CTCGCCTCGATGCGCCGCCATCTTGAAGCCGTCGGCAAACCGGGTGGGCTGTTCGACGACCATGTGGTGT
CTCACCTTCCGTGGCGCGGTAGCAATCGGCGTATTCGCCTGGTGGTCTACCGCTGGCTCGGGGAGCAGGC
TGACGAGGATGGGCAGAGCCCGGTCCAGCTGTTGAACCGCACCTGCGACCGCTTGGTGGCCTCGCTGCAG
GCCTGCGGGGTCAGCCCTCGGCGGCTGACCGGGCGCGACTTTTACGCCTGGTTGTTGCCTTGGTTCAACC
CGGCACCAGCCCTCACTGGCGAATCCCCCGCCGCGTTCTATCGACGTGTGCCCTACCCGGAAGTGGATGA
CGGTGAGGAGCTGCCGCTGCCGTTCGACCACGATTTCGCCGAGCGGCTGTTCTTTCAGGAACCACGCTCA
AATAGCGAGCAAGGTCTGTGGTACTTCGATCAGCAACCGCACGCCGTGATGGTGGTCGACAAGCTGCGCA
GGCCGCCGCATATCGGCCAGCTGACCGGTGAAACGCGCAAAGGCGAAGCGTTGAACGCCTTGTTCGATCA
GTTGCCCGAGCAGTCGGTCATGAGCCTGACCTTGGTGATCACGCCCCAGGATGTGCTCGAGGAGCAGCTC
AATCGCCTGGCGCGCAAAGCCATCGGCGAGAACCTCGCCTCGACCCAGACCCGCCAGGACGTGGAGGAGG
CCCGCGCGCTGATTGGCCGCCAACACAAACTGTACCGCGGCACGTTGGCGCTGTACCTGCGCGGTGCCGA
TGAGCAGCAGCTGCGCCAACGTTCGGTCCAGGCAGCTAACGTCCTGCTCGGCGCCGGCCTGCAGCCGGTG
CGCGAGGGCGATGAAGTGGCCGCGTGCAACAGCTATCTGCGCTGGTTGCCGATGGTCTACAACCCGGCGC
GGGACACACGCAACTGGTACACCCGGCTGCTGTTTGCTCAGCACGTCGCCAATCTGCTGCCCCTCTGGGG
GCGCAGCATCGGTACCGGCAACCCGGGTATTACCTTCTTCAACCGCGGTGGTGCGCCGCTGTCATTCGAC
CCGCTGTCGCGCTTCGACCGCTCCATGAACGGCCACCTGCTGCTATTTGGCCCTACCGGCGCCGGCAAGT
CGGCCACCCTGGTTTCAATCCTGATGCAGGTCATGGCCGTGTACCGACCGCGGCTGTTCATCGTCGAAGC
GGGCAACTCCTTTGGCCTGCAGGGCGACTACTTCGCCACGCTCGGGCTAACCGTCAACAAGGTTCAGCTC
AAACCAGGCAGCGATGTGAGCCTGGCGCCGTTCGCCCATGCCCGGCGCCTGATAGAGCATCCGGACCAGG
TCGCCAGTCTGTCAACCGAAGAACTGGATGAGGCCGCGCCGGACAGTGGCGAGCAGCGCGATGTACTGGG
CGAGCTGGAGATCACCGCGCGGCTGATGATCACCGGCGGCGAAGCCAAGGAAGAGGCGCGCCTGACTCGC
GCAGACCGCAGTCTGATCCGCGAGTGCATCCTCGACGCCGCCCGGCACTGCGCGACGACTGAGCAGCAGG
TGCTGACCCGCCATGTCCGCGATGCCCTGCGTAAGGTCGCCAGCGACACCCACCTGCCTGACAAACGCCG
CGAGCGTGCGCAGGAGATGGCCGAGTCGATCGACCTGTTCTGCCAGGGCTTTGAAGGTGCCTTGTTCGAC
CGCGCCGGCACACCCTGGCCGGAGAGCGACGTGACGATCGTCGACCTCGCCACGTACGCCCGTGAGGGTT
ACGAGGCGCAGATGTCGATCAGCTACATCAGCCTGATGAACACCGTGAACAACATTGCCGAGCGCGACCA
GTACCTCGGCCGCCCGATCATCATGGTCACCGACGAAGGCCACATCATCACCAAGAACCCGCTGCTGGCC
CCCTTTGTGGTCAAGGGCACGAAGATGTGGCGCAAGCTCGGCGCCTGGTTCTGGCTGGCAACGCAGAACA
TGGCCGACTTGCCCGATGCCGCGCAGACCATGCTCAACATGATTGAGTGGTGGATCTGCTTGAACATGCC
GCCAGCGGAAATCGAGGAGATCGCCCGCTTCAAGAAACTCACGCCGGCGCAGAAGGTACTGCTGCTCTCC
GCGAGCAAGGCCTCGGGCAAGTACACCGAGGGCGTGGTCCTGTCGAAGAACCTGGAGACGCTGTTCCGCG
CAGTGCCGCCGAGCCTGTACCTCGCTTTGGCCATGACCGAGCCCGAGGAGAAAGCCCAGCGCTGGCGATT
GATGGAAGAGCACCAGCAGCCTGAGCTGGAAGCCGCCCTGCAGGTCGCGGCGGAGATTGATCGCCTGCGT
GGCATGTCATAA
 Primer design