SecReT4
Protein ID: 148548163
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2953
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3334579..3335610 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDA5W4M1
KEGG IDppf:Pput_2953
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 9.8e-92, Aligned region: 60..328
Protein Sequence: 343 a.a.     [Download]
>gi|148548163|ref|YP_001268265.1| unnamed protein product [Pseudomonas putida F1]
MLKLGAWMHTAATCRALPMNVTVFTRSKAPKSRKARRGRAFTATALLVAAEQCLALTTPTVIASVTSLQC
LEYRVVGICYWLLCTPFGCTVRTSPKIRHFIPELVVSSYADTGANPWSEMSALSTPTPASQGGGNLITPS
PQRDNLPRFKNVDGIGHPGGAALTALAHTLGYACPSGAVPFAPYYLSTLDPLAWRQAIPESVYPQALVPG
MREIGNQALGDMWGSVYPRHGFLVQPDDFKAAAVMAQRASDFITRVGQPHVYLPLQPMPAPGYWPPQPVM
ENNVNNHRWQLLVPVIQNTCAIFPSPTIQSADGAYAWSLWRPYRCCQRMGQTFLFSIDFDGGQ
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3334579-3335610 Pseudomonas putida F1 chromosome, complete genome
ATGCTGAAACTTGGCGCATGGATGCACACCGCTGCCACCTGCCGAGCGTTGCCCATGAACGTCACCGTCT
TCACTCGAAGCAAAGCGCCGAAATCCAGAAAGGCTCGCCGTGGCCGTGCCTTCACCGCCACTGCTCTGCT
GGTGGCCGCCGAGCAGTGCCTAGCATTGACCACTCCTACCGTCATCGCCTCCGTCACTTCGCTGCAGTGC
CTGGAGTACCGGGTCGTCGGCATCTGCTATTGGCTGCTGTGCACACCGTTCGGCTGCACGGTGCGAACCT
CACCGAAGATCCGTCACTTCATTCCCGAGCTGGTGGTATCGAGCTATGCCGACACCGGCGCCAATCCCTG
GAGCGAGATGTCGGCGCTGTCGACGCCGACGCCGGCGTCACAAGGGGGGGGCAACCTGATTACGCCTTCG
CCGCAGCGCGATAACCTGCCCAGGTTCAAGAATGTCGACGGCATTGGCCATCCCGGCGGTGCAGCCCTCA
CAGCTCTCGCGCATACATTAGGTTATGCGTGCCCAAGCGGAGCCGTACCGTTTGCGCCCTACTACCTCAG
CACGCTCGACCCGTTGGCGTGGCGCCAGGCGATCCCCGAGTCCGTCTACCCACAGGCACTGGTCCCGGGG
ATGCGCGAGATCGGCAACCAGGCACTCGGAGACATGTGGGGCAGCGTGTATCCGCGACACGGCTTTCTGG
TGCAGCCCGATGATTTCAAGGCGGCTGCCGTGATGGCCCAGCGCGCCAGCGACTTCATTACCCGTGTCGG
CCAGCCGCACGTTTATCTACCGCTGCAGCCGATGCCGGCTCCCGGCTACTGGCCGCCGCAGCCGGTGATG
GAGAACAACGTCAACAACCACCGCTGGCAGTTGCTGGTCCCGGTAATCCAGAACACCTGCGCCATCTTCC
CCAGCCCAACGATCCAGAGCGCCGACGGCGCCTATGCCTGGTCGCTGTGGCGGCCCTACCGCTGCTGCCA
GCGCATGGGTCAGACGTTTCTGTTCAGCATTGACTTTGATGGAGGCCAGTGA
 Primer design