SecReT4
Protein ID: 148548164
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2954
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3335610..3336965 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDA5W4M2
KEGG IDppf:Pput_2954
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 451 a.a.     [Download]
>gi|148548164|ref|YP_001268266.1| unnamed protein product [Pseudomonas putida F1]
MKNLALGLVCFLVSTAGHAAENGYHLGDQAQVLDDRVMYTIGGGSAAGAPSSLYRPNGLGVGMSWRANMM
CGNMNLSNTLQNQLNGATQGFQQIMGNVIQNATQAVMSLPAMIIQRANPGLYELLSNGVLQGRIDFDRSK
LTCQAMAAKMADKVDQAGWGALAQNQEMQHNLEQSGGDAVMAVKDTESNNGNNGVSWVGGQKAGGNGQQP
IRVTSDVVKAGYNLLHNRSVEDTSAVGSGCQNGAICQAWSSPEEASEWATRVLGETEVETCDDCETLRVT
AGTGLSPLIQETYTEHLEGLQHMVSRADQPTPENLSKVSSPLLQVSRGVIEGLRDDPDQNLLARRLASET
ALSSVIYKAMLLQRTLFAGSHEPNVASAQPATTALNSNVETLEREIRLLQTELQVRQSLATNTASLVLDR
HAGGADASRSIDQRDPMPDRLRRAEQERSTP
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3335610-3336965 Pseudomonas putida F1 chromosome, complete genome
ATGAAAAACCTCGCGCTCGGGTTGGTGTGCTTCCTTGTGTCTACCGCAGGCCATGCCGCAGAGAACGGCT
ACCACCTCGGTGACCAAGCCCAGGTCCTGGATGACCGCGTGATGTACACCATCGGCGGCGGCTCCGCGGC
AGGAGCGCCCTCCTCGCTTTACCGTCCAAACGGCCTCGGCGTCGGCATGTCCTGGCGGGCCAACATGATG
TGCGGAAACATGAACCTCTCGAACACCCTGCAGAACCAGCTCAATGGTGCCACCCAGGGCTTCCAGCAGA
TCATGGGCAACGTCATCCAGAACGCCACACAAGCGGTGATGTCGCTGCCGGCGATGATCATCCAGCGCGC
CAACCCTGGGCTGTATGAGCTGCTGAGTAATGGCGTGCTGCAGGGACGCATCGACTTCGATCGTTCCAAG
CTCACCTGCCAGGCGATGGCGGCAAAAATGGCCGACAAGGTCGACCAGGCCGGATGGGGTGCGCTGGCCC
AGAACCAGGAGATGCAGCACAACCTTGAGCAGTCCGGCGGCGATGCCGTAATGGCGGTGAAGGATACCGA
GTCGAACAACGGCAACAACGGCGTCAGCTGGGTCGGTGGGCAGAAAGCCGGGGGTAATGGACAGCAACCC
ATCCGGGTGACTTCGGATGTGGTAAAGGCCGGCTACAACCTGCTGCACAACCGATCCGTCGAGGACACCT
CGGCCGTTGGTTCGGGCTGCCAGAATGGCGCCATCTGCCAAGCCTGGTCGAGCCCCGAGGAGGCCTCGGA
ATGGGCGACACGGGTGCTCGGTGAAACTGAGGTGGAGACCTGTGACGACTGCGAGACGCTGCGTGTAACC
GCCGGTACGGGCCTGTCGCCGCTGATCCAGGAAACCTACACGGAACACCTGGAAGGCCTGCAGCACATGG
TCTCGCGCGCCGACCAGCCTACCCCAGAGAACCTCAGCAAGGTCTCCAGCCCCTTGTTGCAGGTCTCCCG
CGGCGTCATCGAGGGGCTGCGCGATGACCCCGACCAGAACTTGCTGGCCCGGCGCCTGGCCAGTGAGACC
GCGCTGTCCAGCGTGATCTACAAGGCGATGCTGCTACAGCGCACGCTGTTCGCCGGCAGCCACGAACCGA
ACGTGGCATCGGCGCAGCCCGCCACTACCGCCCTCAACAGCAACGTCGAAACCCTGGAACGGGAGATCCG
CTTGCTGCAAACCGAGCTGCAGGTACGCCAGTCGCTGGCCACTAATACCGCCAGCCTGGTCCTCGATCGC
CACGCCGGTGGTGCCGACGCCTCGCGCAGCATCGATCAGCGCGACCCGATGCCGGACCGACTGCGCCGGG
CTGAACAGGAGAGGAGCACGCCATGA
 Primer design