SecReT4
Protein ID: 148548166
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2956
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3337277..3338815 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDA5W4M4
KEGG IDppf:Pput_2956
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6.3e-118, Aligned region: 10..495
Protein Sequence: 512 a.a.     [Download]
>gi|148548166|ref|YP_001268268.1| unnamed protein product [Pseudomonas putida F1]
MNMSTNSYLEYYLSLLAWIINNGIWNTLVDTGLFAAPFGAVILQEWLSARQQGADEGNKGLLSIPRVENR
LWMSYVVIMFGCMPFFPLNLSSVTFDDAASQRCGVTMARPADTAWATTFNTIGEKSANVPVWWFLVHAMS
KGITAAATAAIPCAPDIRAMRMEIDSSRINDQVLLQEVADFTRDCYGFSRSRLFTNRPELDESQSYDASW
IGSTYLLNTPGYYDTDRSRMPRVDWPYDETRDTSLPQLDSGAGYPTCKQWWSDGTIGLRDRLVAAVDPSL
LSQLRGWLTGRTSTEVEDATLRELVSPRQQSLSMAPGQVFQDYGSSARGGSLTQGLNNLATNTGLALGSF
SNFPAMNALRAALPMIQAFLIMGTIISLPLVLLISTYQLKALMTITFALFTLHMLTFWWELARWIDSSML
ETLYNQVSVSDQALLSLPTAGFMDGTVTAQVIEYVMGAMFVLLPMIFIGAMSWAGYNVGSAIQTLLTRGT
EAAQTQAGRGSSQLMTGVQKLK
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3337277-3338815 Pseudomonas putida F1 chromosome, complete genome
ATGAACATGAGCACCAACAGCTACCTTGAGTACTACCTGTCGCTGCTGGCCTGGATCATCAACAACGGCA
TCTGGAATACGCTGGTGGATACCGGGCTGTTCGCCGCTCCCTTCGGTGCGGTCATCCTGCAGGAATGGCT
GTCGGCCCGCCAACAGGGTGCTGACGAAGGCAACAAGGGCCTACTGTCGATCCCTCGCGTCGAGAACCGG
CTGTGGATGAGCTACGTGGTCATTATGTTCGGCTGCATGCCGTTCTTCCCGCTGAACCTGTCCTCCGTGA
CGTTTGACGATGCCGCGAGCCAGCGCTGTGGGGTCACAATGGCCAGGCCCGCCGACACGGCCTGGGCCAC
GACTTTCAACACCATCGGCGAGAAGTCAGCGAACGTGCCGGTGTGGTGGTTCCTAGTGCATGCCATGAGC
AAAGGCATCACCGCCGCTGCCACCGCGGCGATTCCCTGCGCGCCCGACATCCGGGCGATGCGCATGGAGA
TCGATAGTTCGCGGATCAACGACCAGGTGCTGCTACAGGAAGTCGCCGACTTCACCCGGGACTGCTACGG
TTTTTCGCGCTCGCGGCTGTTCACCAATCGCCCCGAGCTGGACGAGTCGCAGAGCTACGACGCGTCCTGG
ATTGGCTCGACTTACCTACTCAACACACCGGGCTACTACGATACCGATCGCTCGCGAATGCCCAGAGTCG
ATTGGCCGTACGACGAGACCCGGGACACCTCTCTGCCTCAGCTCGACAGCGGCGCCGGCTACCCCACCTG
CAAACAGTGGTGGAGCGACGGCACGATCGGACTGCGCGACCGCTTGGTGGCCGCTGTTGATCCTTCATTG
CTATCGCAGCTGCGGGGCTGGCTCACCGGGCGCACCTCTACGGAGGTCGAAGACGCCACCTTGCGCGAGC
TGGTGAGCCCACGGCAGCAATCATTGAGCATGGCACCTGGGCAGGTGTTCCAGGACTATGGCAGTAGCGC
GAGGGGCGGATCGCTGACGCAAGGGCTAAACAACCTGGCCACCAATACCGGTTTGGCCCTAGGCTCGTTC
AGTAACTTCCCGGCGATGAATGCGCTGCGCGCGGCCTTGCCGATGATCCAAGCCTTTCTGATCATGGGCA
CGATCATCAGTCTGCCACTGGTGCTGCTGATCAGCACCTACCAGCTCAAGGCGCTCATGACGATCACATT
CGCGCTGTTCACCCTGCACATGCTCACCTTCTGGTGGGAGCTCGCACGCTGGATCGACTCAAGCATGCTG
GAAACGCTGTACAATCAGGTATCGGTCTCAGACCAGGCGCTGTTGTCGTTGCCGACAGCAGGCTTCATGG
ACGGAACGGTCACCGCGCAGGTGATCGAGTACGTCATGGGCGCAATGTTTGTTTTGCTACCCATGATCTT
TATCGGTGCAATGAGTTGGGCGGGATACAACGTGGGAAGTGCTATCCAGACCCTTCTTACTCGTGGAACA
GAGGCCGCTCAGACACAAGCAGGAAGAGGCTCATCACAGCTAATGACAGGTGTCCAGAAACTCAAATAA
 Primer design