SecReT4
Protein ID: 148550598
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5159
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]50996..54040 [-]
Productconjugative relaxase region-like protein
Component typeTraI_F
UniProt IDA5VG54
KEGG IDswi:Swit_5159
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 7.8e-78, Aligned region: 7..283
AAA_30 [PF13604], Evalue: 6.2e-45, Aligned region: 461..655
Viral_helicase1 [PF01443], Evalue: 7.3e-08, Aligned region: 482..604
AAA_19 [PF13245], Evalue: 9.8e-07, Aligned region: 468..535
UvrD_C_2 [PF13538], Evalue: 8.2e-06, Aligned region: 804..908
Protein Sequence: 1014 a.a.     [Download]
>gi|148550598|ref|YP_001260037.1| conjugative relaxase region-like protein [Sphingomonas wittichii RW1]
MLSVAGVRSASGAANYFAKDDYYTVEGSSEISAWGGEGAEAIGLSGEVSKDAFEGVLNGILPSGEAVAQV
ENRRAGYDLTFSMPKSASVMAYVAGDKRVLDANMAAVKATMAWVEKNLAEGRRDIEGRKVPVQTGNLVYA
LFQHDTSRALDPQAHIHAVIANLTRMPDGKWQALHADKLWSHNSIIGSIYHAFLRAGLERIGYQVDLKGK
HGTFEIAGVPKAVIGEFSQRREEILDHATRLGIKSPEGLREITKRSRDPKLDVEDRAALKQGWIDQAAAH
GFDGKDLRAAAEARAGMASSENALERGYRAIVDAVTGARQTLGALLRPQDPLVDNALARAVKSPAEARAQ
LAVASAVRILSEREAAWPVNLLGKTALDLGLKGVTVDLIERRIDRLVQNRQLIPGVATAADRTGRMVTTQ
EALRTEEKILAAVEEGKGKSEPIVAAADAPQRLQDAAERPLNPGQLAAATMILSSADRTVSVQGAAGTGK
STMLQAVARVAEEEGARITGLAFQNKMVADLAEGAGIKAQTIASFVLANERFVTERDTLGYEAAREKLAG
TMLLVDETSMVSSNEMLKLHQITAALGVDKLVLVGDRQQLSSIDAGKAFAMIQAGGGTMARMDQNIRQRT
DQLRTVAALANIGKAGAALKVLGDRVVEAGEPAAAAADMWLELSPGEREATAVFASGRDARAVINQRIQD
GLIAEGSVKGQAIHLTVFERVNTTREELRYASTYRQGQTLEVGRGGAQDVGIKAGRYDVLKVHANGKVEL
SDGRRRIRFDPQKLSPTEQRDRLQLSEKKDLQLREGDRIRWTANDKQRGLHNAALARVVGVDADGVKVET
ADKVLLTLSLGDPMLSRLDLAYSLNMHMAQGITTDKAITVMSSHERNLSNQRLFNVGVTRVRDELTMVVD
DKEKLARQLDMNPGNKTSSLETLGRLDIDGRKGPGAQPREKFDPGPIDGVNLSDLAPVPSDLPPLPDGAA
SAPAAKAPQAPPDLKPDRGDPLPPLPERSLGLDL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|148550551|ref|NC_009507.1|:c54040-50996 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGCTCTCGGTCGCCGGCGTCCGCTCCGCTTCCGGTGCCGCGAACTATTTCGCGAAGGACGACTATTACA
CGGTCGAGGGCTCGTCCGAGATCAGCGCCTGGGGAGGGGAGGGCGCCGAGGCGATCGGCCTGTCCGGAGA
AGTCTCGAAGGACGCCTTCGAGGGCGTGCTGAACGGTATCCTCCCAAGCGGCGAAGCGGTCGCCCAGGTC
GAGAACCGGCGCGCCGGCTACGACCTCACCTTCTCCATGCCGAAGTCGGCTTCGGTCATGGCCTATGTCG
CCGGCGACAAGCGCGTGCTTGACGCCAATATGGCCGCGGTCAAGGCGACCATGGCCTGGGTCGAGAAGAA
CCTCGCGGAAGGGCGTCGCGACATCGAGGGGCGCAAGGTCCCGGTCCAGACGGGCAATCTCGTCTACGCG
CTCTTCCAGCACGACACGAGCCGGGCGCTCGATCCGCAGGCCCACATCCACGCCGTCATCGCCAACCTCA
CCCGCATGCCCGATGGCAAATGGCAGGCACTCCACGCCGACAAACTCTGGAGCCACAACAGCATCATCGG
CTCGATCTACCATGCTTTCCTGCGCGCCGGGCTCGAGCGGATCGGCTATCAGGTGGACCTCAAGGGCAAG
CATGGCACCTTTGAGATTGCCGGCGTTCCCAAGGCGGTCATCGGCGAATTCAGCCAGCGCCGCGAGGAGA
TCCTCGATCACGCAACGCGGCTCGGCATCAAGTCGCCGGAGGGCCTGCGCGAAATCACCAAACGCTCGCG
CGATCCCAAGCTCGACGTCGAGGACCGCGCCGCGCTGAAGCAGGGCTGGATCGACCAGGCCGCTGCCCAC
GGCTTCGACGGCAAGGACCTGCGGGCAGCAGCCGAGGCGCGCGCCGGGATGGCGTCTTCGGAAAATGCTC
TCGAGCGCGGCTACCGCGCCATTGTCGATGCCGTAACTGGTGCCCGCCAGACGCTGGGTGCGCTGCTCCG
CCCCCAGGACCCTTTAGTGGACAATGCGCTCGCCCGCGCGGTCAAGTCGCCAGCGGAAGCGCGCGCGCAG
CTCGCGGTCGCGTCCGCCGTCCGGATCCTCTCCGAACGTGAGGCCGCATGGCCCGTCAATCTGCTCGGCA
AGACCGCGCTCGATCTCGGTCTCAAGGGCGTCACCGTCGACCTGATCGAGAGGCGGATCGACCGGCTCGT
GCAGAACCGTCAGCTCATCCCGGGCGTCGCGACAGCCGCGGACCGGACTGGCCGCATGGTGACCACGCAG
GAGGCGCTGCGGACCGAAGAGAAGATTCTTGCCGCCGTCGAGGAGGGGAAAGGGAAGTCCGAGCCAATTG
TGGCGGCCGCCGATGCGCCGCAGCGATTGCAGGATGCCGCCGAACGGCCGCTCAATCCTGGGCAGCTCGC
CGCCGCGACGATGATCCTGTCATCCGCCGATCGTACCGTCTCGGTGCAGGGCGCCGCCGGCACGGGCAAG
TCCACCATGCTCCAGGCGGTCGCGCGGGTCGCCGAGGAGGAGGGCGCCCGGATCACCGGACTTGCCTTCC
AGAACAAGATGGTCGCGGACCTCGCCGAAGGGGCGGGCATCAAGGCCCAGACGATCGCTTCCTTCGTGCT
CGCCAACGAGCGGTTCGTGACCGAGCGTGACACGCTGGGATATGAGGCTGCGCGCGAGAAGCTCGCCGGT
ACCATGCTTCTCGTCGACGAAACCTCGATGGTGTCGTCGAACGAAATGCTCAAGCTCCACCAGATCACAG
CAGCCTTGGGCGTCGACAAGCTCGTTCTGGTCGGTGACCGGCAGCAGCTCTCTTCGATCGACGCGGGCAA
GGCCTTCGCCATGATCCAGGCGGGCGGCGGCACGATGGCGCGGATGGATCAGAATATCCGCCAACGCACC
GACCAACTGCGCACCGTCGCGGCGCTCGCCAATATCGGCAAGGCCGGCGCGGCGCTGAAAGTGCTGGGGG
ACCGTGTCGTCGAGGCGGGGGAGCCGGCCGCCGCTGCGGCCGACATGTGGCTCGAGCTCTCCCCTGGCGA
ACGGGAGGCGACCGCTGTCTTCGCTTCGGGCCGCGACGCGCGCGCCGTCATCAACCAGCGCATCCAAGAT
GGCCTGATCGCGGAAGGGAGCGTCAAGGGCCAGGCGATCCATCTCACTGTCTTTGAGCGGGTCAACACCA
CGCGCGAGGAGCTGCGCTATGCCTCGACCTACCGTCAGGGCCAGACGCTCGAGGTCGGCCGCGGCGGCGC
GCAGGACGTCGGGATCAAGGCGGGACGCTACGACGTCCTCAAGGTCCACGCCAACGGGAAGGTCGAACTG
TCGGACGGTCGGCGCAGGATACGCTTCGATCCCCAGAAGCTGTCGCCGACCGAGCAGCGCGATCGCCTGC
AGCTTTCTGAAAAGAAGGACCTTCAGCTGCGCGAAGGGGACCGCATCCGCTGGACGGCCAACGACAAGCA
GCGCGGCCTGCACAATGCCGCGCTTGCGCGCGTTGTGGGCGTCGATGCCGATGGCGTGAAGGTTGAGACT
GCGGACAAGGTGCTCCTCACGCTCAGCCTCGGTGACCCGATGCTATCTCGGCTCGACCTTGCTTATAGCC
TTAATATGCACATGGCCCAGGGGATCACCACCGACAAGGCGATCACCGTCATGTCGTCGCATGAGCGCAA
CCTCTCGAACCAGCGCCTCTTCAACGTCGGGGTCACGCGCGTGCGCGACGAGCTGACAATGGTCGTGGAC
GACAAGGAGAAGCTCGCGCGGCAGCTCGACATGAATCCCGGCAACAAGACCTCCTCGCTCGAGACGCTCG
GCCGCCTCGATATCGACGGCAGGAAGGGGCCGGGCGCGCAACCCCGCGAGAAGTTCGATCCCGGTCCGAT
CGACGGCGTCAACCTGTCCGATCTTGCTCCCGTTCCAAGCGATCTGCCGCCTCTGCCCGATGGCGCGGCA
TCTGCGCCGGCCGCGAAGGCCCCACAAGCGCCGCCCGATCTGAAACCCGATCGCGGCGATCCGCTGCCAC
CGCTGCCCGAGCGCAGCCTCGGGCTCGACTTGTGA
 Primer design

Protein ID: 148550660
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5223
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]113404..116436 [-]
Productconjugative relaxase region-like protein
Component typeTraI_F
UniProt IDA5VGB6
KEGG IDswi:Swit_5223
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 8.9e-80, Aligned region: 7..283
AAA_30 [PF13604], Evalue: 4.8e-45, Aligned region: 457..649
Viral_helicase1 [PF01443], Evalue: 3.8e-08, Aligned region: 478..605
UvrD_C_2 [PF13538], Evalue: 1.8e-06, Aligned region: 800..904
Protein Sequence: 1010 a.a.     [Download]
>gi|148550660|ref|YP_001260099.1| conjugative relaxase region-like protein [Sphingomonas wittichii RW1]
MLSVASVRSASGAANYFAKDDYYTVEGSSEISAWGGEGAGALGLSGEVGKDAFEGMLNGILPSGEGVAQV
ENRRAGLDLTFSMPKSASILAYVAGDKRILAANMAAVQKTMAWVEKNLAEGRKDIGGRTVPVATGNLVYA
LFQHDTSRALDPQGHIHAVIANLTRLPDGKWQALHADKIWSHNTVIGSIYHAYLREGIEQLGFRIEALGK
HGTFEIAGVPRKVIDAYSQRREAILEKAAALGIVSHKGRDQITTNTRDPKLNVKDRDALKQEWIDKAASL
GFDGKALVEGALARSDRHGALGPLERGYKAVTEAIAAGREKLGDLVRPADPLVDRGLARVTQSPAIARAQ
LAVASAVRIHSEREAAFPIHRLAKTALDLGLKDVTIDRIEQRIQQLVARGTLLRGQERAADFVTTRQALA
TETQILTQVEAGRGQANPIIDASEAPGRLQAAATQPLNTGQLAAATLILGSADRTVSIQGIAGAGKSTML
QAVARVAEAEGRAITGLAFQNKMVADLAEGAGVPAQTIASFVLAHERYVAEPQGPGYDAARAAHAGSMLV
VDETSMVSSNDMLKLHAIVETLGVDKLVLVGDRQQLSSIDAGKSFAMIQAAGGTLARMDENIRQRTDVLR
TVAALANIGKASEAMRVLGDKVIEASQPAEHAADLWLALDPAERQATAVFASGREARAAINERIQAGLAA
EGSLEGEGIHLTVYERVNTTREELRYAATYRAGMTLEVGRGGGQDIGLRAGRYDVLAVHANGKVELGEGR
RRIRFDPLKLSPTETRDRLQLTEKKDLHLRAGDRIRWTANDKPRGLTNASLARVVAVDRDSVTVETAGRD
RLVLAFGDPMLSRVDLAYALNMHMAQGITTDKAITVMDSHERNLSNQRLFNVGVTRVRDDLTMVVDDKAK
LERQLDHNPGNKTSALETLGRLEIDGPGRAQASGPFDPGPVEGGPGPKAAEGLDGFPPVPPAEGQVAARA
KSDDLSAPRLKPEQADLLPPLPERSLGLDL
 
Nucleotide Sequence: 3033 bp     [Download]
>gi|148550551|ref|NC_009507.1|:c116436-113404 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGCTGTCGGTCGCCTCGGTCCGCTCGGCTTCGGGCGCCGCGAATTATTTCGCGAAGGACGACTATTACA
CCGTCGAAGGATCCTCCGAGATCAGCGCCTGGGGCGGGGAGGGCGCGGGGGCGCTCGGGCTGTCGGGAGA
AGTGGGTAAGGATGCGTTCGAGGGCATGCTCAACGGCATCCTGCCTTCGGGAGAAGGGGTGGCTCAAGTA
GAGAACCGCCGGGCCGGCCTCGACCTCACCTTCTCCATGCCCAAGTCAGCCTCGATCCTGGCCTATGTGG
CGGGCGACAAGCGCATTCTCGCCGCCAACATGGCGGCGGTCCAGAAGACGATGGCCTGGGTCGAGAAAAA
CCTCGCCGAAGGTCGCAAGGATATCGGCGGGCGAACCGTCCCTGTCGCGACCGGCAACCTCGTCTATGCC
CTCTTCCAGCACGACACGAGCCGTGCCCTCGATCCCCAGGGGCATATCCATGCAGTGATCGCCAACCTGA
CCCGTCTGCCCGACGGCAAATGGCAAGCGCTCCACGCGGACAAGATCTGGAGCCACAACACCGTCATCGG
CTCGATCTACCACGCCTATCTGCGCGAAGGCATCGAGCAGCTCGGTTTCAGGATCGAGGCGCTCGGCAAG
CACGGCACCTTCGAGATCGCCGGCGTACCGCGCAAGGTGATTGATGCCTACAGCCAGCGCCGCGAAGCGA
TCCTCGAAAAGGCGGCGGCGCTTGGCATCGTCTCGCACAAGGGCCGCGACCAGATCACCACCAATACCCG
CGATCCCAAGCTCAATGTCAAGGATCGCGACGCCCTCAAGCAGGAATGGATCGACAAGGCGGCGTCGCTC
GGATTCGACGGAAAGGCCCTCGTCGAGGGCGCCCTGGCGCGGTCCGATCGCCATGGGGCGCTCGGACCGC
TCGAACGCGGCTACAAGGCGGTGACCGAGGCGATCGCCGCCGGGCGCGAAAAGCTCGGCGACCTTGTCCG
GCCCGCGGATCCTTTGGTCGATCGCGGCCTTGCCCGCGTCACCCAGTCGCCCGCCATCGCGCGGGCCCAG
CTCGCGGTCGCCTCGGCAGTCCGTATTCATAGCGAACGCGAGGCGGCCTTTCCCATCCATCGCCTTGCCA
AGACCGCGCTCGACCTTGGCCTCAAGGACGTGACGATCGATCGGATCGAACAGCGGATCCAGCAACTCGT
CGCGCGCGGCACGCTGCTCAGGGGACAGGAGCGCGCAGCTGACTTCGTCACCACCCGGCAGGCACTAGCC
ACGGAAACCCAGATCCTGACCCAGGTAGAGGCGGGCCGCGGACAGGCGAACCCAATCATCGACGCGTCCG
AGGCGCCGGGCCGCCTGCAGGCCGCAGCGACGCAGCCCCTCAATACAGGCCAGCTCGCCGCCGCTACCTT
GATCCTCGGCTCGGCCGACCGCACGGTCTCGATCCAGGGCATCGCCGGCGCCGGCAAGTCGACGATGCTT
CAGGCCGTCGCCCGCGTGGCGGAGGCGGAAGGACGCGCCATCACCGGCCTTGCCTTCCAGAACAAGATGG
TCGCCGACCTGGCCGAAGGCGCAGGCGTCCCTGCGCAAACCATCGCCTCTTTCGTGCTTGCCCATGAACG
GTATGTCGCCGAACCGCAGGGCCCGGGCTATGATGCGGCGCGGGCGGCACATGCCGGATCGATGCTGGTC
GTCGACGAGACCTCGATGGTGTCGTCGAACGATATGCTCAAGCTGCACGCCATCGTCGAGACGCTTGGCG
TCGACAAGCTCGTGCTGGTTGGTGACCGGCAGCAGCTCTCCTCGATCGATGCGGGCAAATCCTTCGCCAT
GATCCAGGCGGCGGGCGGCACGCTGGCGCGCATGGACGAGAATATCCGCCAGCGGACCGACGTCCTGCGC
ACCGTCGCCGCGCTTGCCAATATCGGCAAGGCAAGCGAGGCGATGCGGGTGCTGGGCGACAAGGTCATCG
AAGCCTCCCAGCCCGCAGAACATGCCGCCGATCTCTGGCTGGCGCTCGATCCCGCGGAGCGCCAGGCGAC
CGCGGTCTTTGCCTCGGGACGCGAGGCACGTGCGGCGATCAACGAGAGGATCCAGGCGGGTCTTGCCGCC
GAAGGATCGCTGGAAGGGGAGGGCATCCATCTCACGGTCTATGAGCGGGTCAACACGACGCGCGAGGAAC
TGCGCTACGCGGCCACCTACCGCGCCGGCATGACGCTCGAGGTCGGTCGGGGCGGCGGCCAGGACATAGG
GCTCCGCGCCGGGCGCTACGACGTCCTGGCTGTCCACGCCAATGGCAAGGTCGAGCTGGGCGAAGGCCGC
CGCCGTATACGTTTCGATCCGCTGAAATTGTCGCCGACCGAGACACGCGATCGCCTCCAGCTGACCGAGA
AGAAGGATCTCCACTTGCGGGCCGGTGACCGCATACGCTGGACGGCCAACGACAAGCCGCGCGGCCTGAC
CAACGCCTCGCTCGCCCGGGTTGTCGCCGTCGATCGCGACAGCGTGACAGTCGAGACGGCGGGGAGGGAC
CGGCTCGTGCTCGCGTTTGGCGATCCCATGCTGAGCCGGGTGGACCTGGCCTATGCGCTCAACATGCACA
TGGCGCAGGGGATCACCACCGACAAGGCGATCACGGTCATGGATAGCCATGAGCGCAACCTGTCGAACCA
GCGCCTCTTCAACGTCGGCGTCACCCGCGTGCGCGACGACCTCACCATGGTGGTCGACGACAAGGCGAAG
CTCGAGCGGCAACTCGACCACAACCCCGGGAACAAGACCTCTGCGCTCGAGACCCTGGGCCGGCTCGAAA
TCGACGGTCCGGGAAGGGCGCAGGCATCCGGCCCATTCGATCCGGGACCTGTCGAAGGCGGACCTGGTCC
CAAAGCGGCCGAAGGACTCGATGGCTTTCCGCCGGTGCCCCCGGCCGAAGGGCAGGTGGCCGCCAGGGCG
AAGTCTGATGATCTGAGCGCGCCGCGCCTCAAGCCCGAACAAGCCGATCTGCTGCCCCCGCTGCCCGAAC
GCAGTCTGGGCCTCGATTTGTAA
 Primer design