SecReT4
Protein ID: 148550599
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5160
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]54040..56346 [-]
Producthypothetical protein
Component typeTraD_F
UniProt IDA5VG55
KEGG IDswi:Swit_5160
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 4.5e-145, Aligned region: 224..609
TraG-D_C [PF12696], Evalue: 1e-16, Aligned region: 469..590
T4SS-DNA_transf [PF02534], Evalue: 1.2e-13, Aligned region: 429..591
AAA_10 [PF12846], Evalue: 1.8e-13, Aligned region: 240..547
DUF87 [PF01935], Evalue: 1e-05, Aligned region: 239..283
Protein Sequence: 768 a.a.     [Download]
>gi|148550599|ref|YP_001260038.1| hypothetical protein Swit_5160 [Sphingomonas wittichii RW1]
MAREDIRTDGRPVPLTHHSARGRVQRNAGNFTRGSQLLTHEMLMWFSGAKLPFILWFFAFLAAWFIIMSL
KLDEHGFQLVCMKVYATLWNWIDLNPNKRVNVTLPNGDLMRTVMKAVPYIPEVITAWAVAMRGLIGAFLI
SVFITIPAAIWFVDISHRRGRSILQERHERGAMLVDRSVLLVEINEHNRVKFEEEAADLFPGLSSRQVLA
LPFRARKEAGIHHPYTLAGIPFPHRTEQSHAMLIGTTGSGKTTELRSLVTQMRERQDTAVIFDLTGAYVE
AFYDPTRDTILNPMDARCPAWSIFNDCRTHSEFTAAAAALIPSDGGSSEPFWALAARTLFIEMCIRLMER
GQTSNLALSENLMTADLKRVHRFLANTIADPLTAPEAARMAESIRAVFNTNAQVLRFLPDEGESFSIRDW
ITRDKKPGSILFVTSNYVDLPMNRALLTLWMDLAINRLMTLPRTRSLRTWFMFDELGALHRLPAIENGLQ
TARAFGGAMILGIHSFEKLVEVYGEQGARNLASLARSKLILATADLDTAEQCARYIGNREVRQMDEAYSY
GYNNTRDASTLTPRKQVEPLVIADDITNLPSMHGFVKFPDGFPAARILLEWKDYPQVAQGFVQRPDVGPV
RSRRGEEVFEEDGAGEAGGRDGSLQVVEEVAEITNLARDLAARILSAEVEEEDDAARRAAQRADDRDEQA
TPGTHSADRAQAARASGEEQPVSARDRDDRRDGHRHGETSPQVEDQTLIELRHDFSTGREDDGMDMGI
 
Nucleotide Sequence: 2307 bp     [Download]
>gi|148550551|ref|NC_009507.1|:c56346-54040 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGCGCGTGAGGACATCCGCACGGACGGGCGTCCCGTCCCGCTCACCCATCATTCGGCGCGCGGCCGCG
TGCAGCGCAATGCCGGCAATTTCACCCGCGGCAGCCAGCTACTCACCCATGAGATGCTGATGTGGTTCTC
GGGCGCCAAGCTGCCCTTCATCCTCTGGTTCTTCGCCTTTCTCGCCGCCTGGTTCATCATCATGTCGCTC
AAGCTCGACGAGCATGGTTTCCAGCTCGTCTGCATGAAGGTCTATGCGACCCTCTGGAACTGGATCGACC
TCAATCCGAACAAGCGCGTCAACGTCACGCTGCCGAACGGCGACCTCATGCGCACCGTGATGAAAGCGGT
GCCCTATATTCCCGAGGTCATCACAGCCTGGGCCGTCGCGATGCGGGGCCTCATCGGCGCTTTCCTGATC
TCGGTCTTCATCACCATTCCGGCCGCCATCTGGTTCGTCGACATCTCGCATCGGCGCGGCCGTTCGATCC
TTCAGGAACGGCATGAACGCGGCGCCATGCTGGTTGATCGCAGCGTGCTTCTGGTGGAGATCAACGAGCA
TAACCGGGTGAAGTTCGAAGAGGAGGCGGCCGACCTCTTCCCCGGCCTGTCCTCGCGGCAGGTTCTCGCG
CTCCCGTTCCGAGCGCGCAAGGAAGCCGGCATCCATCATCCCTACACGCTCGCGGGCATCCCCTTTCCGC
ACCGCACCGAACAATCCCATGCGATGCTCATCGGCACCACCGGATCAGGCAAGACGACCGAGCTCAGAAG
CCTCGTCACCCAGATGCGCGAGCGCCAGGACACGGCCGTCATCTTCGATCTCACCGGCGCCTATGTCGAA
GCCTTCTACGATCCCACACGCGACACGATCCTCAATCCCATGGACGCGCGCTGCCCGGCCTGGTCGATCT
TCAACGATTGCCGCACCCACAGCGAATTCACGGCCGCCGCGGCGGCGCTAATCCCTTCGGATGGCGGTTC
GTCCGAACCCTTCTGGGCGCTCGCAGCGCGCACCCTCTTCATCGAGATGTGCATTCGCCTGATGGAGCGG
GGGCAGACCAGCAATCTGGCGCTGTCCGAGAACCTGATGACGGCCGACCTGAAGCGCGTCCACCGCTTCC
TCGCCAACACCATCGCCGACCCGCTCACTGCCCCCGAAGCGGCCCGCATGGCGGAATCGATCCGCGCCGT
CTTCAACACCAATGCGCAGGTCCTTCGCTTCCTTCCCGACGAGGGCGAATCCTTCTCGATCCGCGACTGG
ATCACGCGGGACAAGAAGCCCGGATCGATCCTGTTCGTGACGTCGAACTATGTCGATCTGCCGATGAACC
GGGCGCTGCTCACGCTGTGGATGGATCTCGCGATCAACCGGCTGATGACGCTGCCGCGCACCCGCAGCTT
GCGCACCTGGTTCATGTTCGACGAGCTTGGCGCACTGCATCGCCTTCCGGCGATCGAGAATGGTCTCCAG
ACGGCGCGCGCGTTTGGCGGCGCGATGATCCTGGGCATCCACAGCTTCGAGAAGCTGGTCGAAGTCTATG
GCGAGCAAGGGGCACGCAATCTCGCCTCGCTCGCCCGCTCCAAGCTCATCCTCGCGACGGCCGATCTCGA
CACGGCCGAGCAGTGCGCGCGCTACATCGGCAACCGCGAGGTTCGCCAGATGGATGAGGCCTATAGCTAC
GGCTACAATAACACCCGCGACGCTTCGACCCTGACCCCGCGCAAGCAGGTCGAACCACTCGTCATCGCCG
ATGACATCACCAACCTGCCCTCGATGCACGGCTTCGTGAAATTCCCCGACGGCTTCCCCGCCGCGCGCAT
CCTGCTCGAGTGGAAGGACTATCCCCAGGTCGCCCAGGGCTTCGTCCAACGGCCCGATGTCGGGCCGGTA
CGCTCAAGGCGCGGAGAGGAGGTGTTCGAGGAAGACGGGGCAGGGGAGGCGGGCGGGCGCGACGGCTCGT
TGCAGGTCGTGGAGGAAGTGGCCGAGATCACCAATCTCGCCCGCGATCTCGCCGCACGGATCCTGTCGGC
CGAGGTCGAGGAGGAGGACGATGCCGCCCGCCGCGCGGCGCAGCGGGCGGACGACCGGGACGAACAGGCG
ACGCCTGGCACGCATAGCGCGGACAGGGCGCAGGCGGCGCGCGCCAGCGGCGAGGAACAGCCGGTTTCCG
CGCGCGACCGGGACGATCGTCGTGATGGCCACCGGCACGGGGAGACGAGCCCACAGGTCGAGGACCAGAC
CCTGATCGAGCTGCGCCACGACTTCTCCACCGGCCGCGAGGATGACGGCATGGACATGGGCATCTGA
 Primer design