SecReT4
Protein ID: 148550661
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5224
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]116438..118729 [-]
Producthypothetical protein
Component typeTraD_F
UniProt IDA5VGB7
KEGG IDswi:Swit_5224
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.2e-143, Aligned region: 225..610
TraG-D_C [PF12696], Evalue: 8.6e-16, Aligned region: 470..591
T4SS-DNA_transf [PF02534], Evalue: 9.8e-13, Aligned region: 430..593
AAA_10 [PF12846], Evalue: 2.3e-12, Aligned region: 241..548
DUF87 [PF01935], Evalue: 1.8e-05, Aligned region: 240..287
Protein Sequence: 763 a.a.     [Download]
>gi|148550661|ref|YP_001260100.1| hypothetical protein Swit_5224 [Sphingomonas wittichii RW1]
MARKNDIRTDGRAIPLTHHSARGRVQRNSGNFTRGSQLLTHELLMWFSGAKLPILMWFFLFAAAWFVIMS
IKLDEHGFQLICMKIYAALWNWVDLNPNKRVNVTLPSGEVMRTVMPAVPYIAEVIQAWKIAMKGLLAAFF
VSIFITIPVALWFVDLSRRRGKTILQERHERGAMLVARHVLLNEISQHNYAKFEEEAQDRLPGLAPAKIL
DMPFRARKAAGIHHPYTLAGIPYPHRTEQSHTMLIGTTGSGKTTELRSLVSQVRAREDTAVIFDLTGAYV
EAFYDSARDTILNPMDARCPAWSIFNDCTTHSEFTAAAAALIPSDGGSAEPFWALAARTLFIEMCIRLQE
RGATTNLALSENLMTADLKRVHRFLANTIADPLTAPEAARMAESIRAVFNTNAQVLRFLPDEGPRFSIRD
WTTTEKKPGAILFITSNYVDLAMNRALLTLWMDIAINRLMTMPRTRDLRTWFMFDELGALHRLPAIENGL
QTARAFGGAMILGIHSFEKLIEVYGEQGARNLASLARSKLMLATADLDTAEQCARYIGNREVRQMDEAYS
YGYNNTRDAATLTPRKQVEPLVIADDITNLPSMHGFVKFPDGFPAARIQLQWKDYPQVAQGFIARPNLQP
VRSRRGEEAFEGSDGGEAGGRDGAAQVIGEVADPVNLAKELAANILSAEVEDEHDEAARRAQRAAESDER
PATPTHAADRAQAARAATGDPQTVPRDRDGRGQPAPVPQVEDQTLVELRQAFGREDDGMDMGI
 
Nucleotide Sequence: 2292 bp     [Download]
>gi|148550551|ref|NC_009507.1|:c118729-116438 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGCGCGTAAAAACGATATCCGCACAGACGGCCGGGCCATCCCCTTGACCCATCACAGCGCGCGCGGAC
GGGTGCAGCGCAATTCGGGCAATTTTACCCGCGGCTCGCAGCTTCTCACCCACGAACTTCTGATGTGGTT
CTCGGGTGCGAAACTGCCCATCCTGATGTGGTTCTTCCTCTTCGCGGCCGCCTGGTTCGTGATCATGTCG
ATCAAGCTCGACGAGCACGGCTTCCAGCTCATCTGCATGAAGATTTATGCCGCGCTCTGGAACTGGGTCG
ACCTCAACCCCAACAAGCGCGTCAACGTCACCCTGCCGAGCGGCGAGGTCATGCGTACGGTGATGCCCGC
GGTGCCTTATATCGCCGAGGTCATCCAGGCCTGGAAGATCGCGATGAAAGGCCTTCTGGCGGCCTTCTTC
GTATCCATCTTCATCACCATCCCGGTCGCACTCTGGTTCGTCGATCTTTCGCGCCGGCGGGGCAAGACGA
TCCTTCAGGAACGCCACGAGCGCGGAGCCATGCTGGTCGCCCGCCACGTGCTTCTCAACGAGATCAGCCA
GCACAATTACGCGAAGTTCGAAGAGGAGGCGCAGGATCGCCTGCCCGGCCTCGCCCCGGCCAAGATTCTC
GACATGCCGTTTCGTGCACGCAAGGCGGCGGGCATCCATCACCCCTATACGCTTGCGGGCATCCCTTATC
CGCATCGCACCGAGCAGTCGCATACCATGCTCATCGGTACGACCGGATCGGGCAAGACGACCGAACTCAG
GAGCCTGGTTTCGCAGGTGCGAGCCCGCGAGGACACGGCCGTCATCTTCGATCTCACCGGCGCCTATGTC
GAAGCCTTCTACGATTCCGCGCGCGATACGATCCTCAACCCGATGGACGCGCGCTGCCCGGCCTGGTCGA
TCTTCAACGACTGCACCACGCATAGCGAATTCACTGCCGCAGCGGCGGCGCTCATTCCCTCGGACGGCGG
CTCTGCCGAACCCTTCTGGGCGCTCGCGGCGCGCACCCTCTTCATCGAGATGTGCATCCGGCTCCAGGAG
CGCGGCGCGACGACCAATCTCGCGCTCTCCGAGAACCTGATGACGGCCGACCTGAAGCGGGTTCACCGTT
TCCTTGCCAACACGATCGCGGACCCGCTCACCGCGCCGGAAGCCGCACGCATGGCGGAATCGATCCGCGC
GGTCTTCAATACCAATGCGCAGGTGCTGCGCTTCCTTCCCGACGAGGGGCCACGCTTCTCGATCCGCGAC
TGGACCACGACCGAGAAGAAGCCCGGCGCGATCCTGTTCATCACCTCGAACTATGTCGATCTGGCGATGA
ACCGGGCGCTGCTGACGCTGTGGATGGACATCGCCATCAACCGCCTCATGACCATGCCGCGCACCCGCGA
TCTGCGCACCTGGTTCATGTTCGACGAACTCGGCGCACTCCATCGTCTGCCCGCGATCGAGAATGGTCTC
CAGACCGCCCGCGCGTTCGGCGGCGCGATGATCCTGGGGATCCACAGCTTCGAAAAACTGATCGAGGTCT
ATGGCGAGCAGGGTGCCCGCAATCTCGCCTCGCTCGCGCGCTCCAAGCTGATGCTCGCAACCGCCGATCT
CGACACCGCCGAGCAATGCGCGCGCTACATCGGCAACCGCGAAGTACGGCAGATGGATGAAGCCTATAGC
TACGGCTACAACAACACGCGCGACGCCGCGACGCTGACGCCGCGCAAGCAGGTCGAGCCGCTCGTCATCG
CGGACGACATCACCAACCTGCCCTCGATGCATGGTTTCGTGAAATTCCCTGATGGCTTCCCCGCGGCGCG
CATCCAGCTCCAGTGGAAAGACTACCCCCAGGTCGCCCAGGGCTTCATCGCCCGTCCCAATCTCCAGCCG
GTGCGATCAAGGCGCGGAGAGGAGGCGTTCGAGGGGAGCGATGGGGGCGAAGCGGGCGGGCGCGATGGCG
CCGCGCAGGTGATCGGGGAGGTTGCCGATCCCGTCAATCTGGCCAAGGAACTTGCCGCCAATATCCTGTC
GGCCGAGGTCGAGGATGAGCATGATGAAGCGGCCCGCCGGGCGCAGCGTGCGGCCGAGAGCGACGAGCGG
CCAGCAACCCCCACGCACGCCGCGGACAGGGCACAGGCGGCGCGCGCTGCGACCGGGGATCCTCAGACCG
TGCCGCGCGATCGCGACGGGCGGGGTCAACCTGCGCCAGTGCCCCAGGTCGAGGATCAGACGCTGGTCGA
GCTAAGGCAGGCGTTCGGGCGCGAGGACGACGGCATGGACATGGGGATCTGA
 Primer design