SecReT4
Protein ID: 148550797
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5361
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]269613..270614 [+]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDA5VGQ3
KEGG IDswi:Swit_5361
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 333 a.a.     [Download]
>gi|148550797|ref|YP_001260236.1| lytic transglycosylase, catalytic [Sphingomonas wittichii RW1]
MKTALLAAPLLTIILAAPLAAASPQGSPRTVQLITMGVPAPPRLSAAAGTDGAHGPERPAVDEGAPPAAG
SPAALPASFSVHDLSRKWVQFQMAQTYGQAAVAPGETAPVDVAATGAALPVAAAPGVFAEPTLEPIPVPA
WMRGGLAFASAATRYKPGCYAAGYRPAGFLSAQAEIRRAGYYGMMSAIACQYGLPVGLFDAMIIRESRYN
DRAVSPKNAYGLTQLMPGTAAGLGVDRYDIEQNLHGGARYLRSQLDRFGQVHLALAAYNAGPGRVRGGQV
PRIAETQAYVDDILLNWRRLSGFTRTANVTGRSLPPTPTSPRFNGRSAVVSRF
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|148550551|ref|NC_009507.1|:269613-270614 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGAAGACCGCGCTCCTTGCTGCACCGCTGCTCACCATCATCCTTGCAGCCCCGCTTGCCGCCGCCAGCC
CGCAAGGTTCGCCGCGCACCGTTCAACTCATCACCATGGGCGTGCCCGCGCCGCCACGCCTGTCGGCCGC
TGCGGGCACAGATGGCGCACACGGCCCGGAAAGGCCGGCGGTAGACGAAGGCGCCCCACCCGCCGCAGGC
AGTCCGGCCGCGCTTCCAGCGTCGTTTAGCGTTCATGACCTCAGCCGCAAATGGGTGCAGTTCCAGATGG
CGCAGACTTATGGGCAAGCGGCCGTGGCCCCCGGCGAGACCGCGCCGGTCGACGTGGCGGCTACCGGGGC
TGCGCTGCCAGTTGCGGCCGCGCCCGGCGTCTTTGCCGAGCCGACGCTGGAGCCGATACCCGTTCCTGCG
TGGATGCGCGGCGGACTGGCCTTTGCCAGCGCCGCAACCCGCTACAAGCCGGGGTGCTACGCCGCAGGCT
ATCGGCCAGCCGGCTTTCTCAGTGCGCAGGCGGAGATCCGCCGGGCGGGCTATTACGGGATGATGAGCGC
GATCGCGTGCCAATATGGCCTCCCGGTCGGCCTTTTCGACGCCATGATCATCCGGGAGAGCCGCTACAAT
GACCGGGCCGTTTCGCCGAAAAATGCCTATGGATTGACGCAGCTCATGCCCGGCACGGCCGCGGGGTTGG
GCGTGGATCGCTACGATATCGAGCAGAATCTGCACGGCGGCGCGCGCTATCTGCGCAGCCAGCTCGATCG
CTTTGGCCAGGTCCATCTGGCCTTGGCGGCTTATAATGCCGGGCCGGGCCGGGTGCGGGGCGGCCAGGTG
CCGCGCATCGCCGAGACCCAGGCCTATGTCGACGACATTCTCCTCAACTGGCGGCGTCTGAGTGGTTTCA
CGCGGACGGCCAATGTCACCGGCCGATCGTTGCCGCCGACTCCCACATCTCCGCGTTTCAATGGACGCAG
CGCGGTCGTCTCGCGCTTCTGA
 Primer design