SecReT4
Protein ID: 148550801
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5365
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]272550..272855 [+]
ProductType IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDA5VGQ7
KEGG IDswi:Swit_5365
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.9e-35, Aligned region: 9..100
Protein Sequence: 101 a.a.     [Download]
>gi|148550801|ref|YP_001260240.1| Type IV conjugative transfer system protein TraL [Sphingomonas wittichii RW1]
MEGGAMSADKYVIPTHLDDPELIGLWTLDEFLAMVIPFTWGILSQHILIGTLLAGAGWWGLKRAKAGRAA
SWLLHMAYWHLPAGFTGMKATPPSYLRLMAG
 
Nucleotide Sequence: 306 bp     [Download]
>gi|148550551|ref|NC_009507.1|:272550-272855 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGAGGGTGGTGCGATGTCTGCGGACAAATATGTCATTCCAACTCATCTGGATGATCCAGAACTGATCG
GGCTGTGGACCCTGGATGAGTTCCTCGCGATGGTGATTCCGTTCACCTGGGGGATCCTGTCTCAGCATAT
CCTTATCGGCACTTTGCTCGCTGGAGCAGGCTGGTGGGGCTTGAAGCGCGCTAAGGCGGGACGGGCGGCA
TCCTGGCTGCTGCACATGGCCTATTGGCATCTTCCGGCCGGGTTTACCGGCATGAAGGCGACACCGCCCT
CCTACCTTCGACTGATGGCCGGCTGA
 Primer design