SecReT4
Protein ID: 148550802
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5366
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]272857..273423 [+]
ProductTraE family protein
Component typeTraE_F
UniProt IDA5VGQ8
KEGG IDswi:Swit_5366
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 7.5e-67, Aligned region: 1..183
Protein Sequence: 188 a.a.     [Download]
>gi|148550802|ref|YP_001260241.1| TraE family protein [Sphingomonas wittichii RW1]
MEIANSHAQSQRVLKQRNLLVAIAGVLAALTAILFLMVATRDREIVLQPILRSPLTISSAGVSREYLEMV
TRDAAVLTLDRSPSNLEYWMKSVLDITAPSAQGRLKADLLKIVNEQRGSSIAQFFAIQSMKLDPDNLTSD
VTGDLHTIVGSKVVSKDRRTFRFKWKYSGVSLQLVGFGMVSKAEEGDQ
 
Nucleotide Sequence: 567 bp     [Download]
>gi|148550551|ref|NC_009507.1|:272857-273423 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGAGATCGCCAACAGCCACGCGCAAAGCCAGCGCGTTCTCAAGCAGCGCAACCTCCTCGTCGCCATCG
CCGGCGTGCTCGCAGCGCTTACCGCCATCCTCTTCCTGATGGTTGCGACCCGCGATCGGGAGATCGTCCT
GCAGCCGATCCTGCGGTCGCCGCTCACAATCAGCAGCGCCGGGGTCAGCCGCGAGTATCTCGAGATGGTT
ACCCGTGATGCCGCGGTGCTGACCCTCGATCGATCGCCCAGCAACCTGGAATACTGGATGAAGTCGGTCC
TCGATATCACGGCGCCAAGCGCACAGGGGCGGCTCAAGGCGGACCTTCTCAAGATCGTCAACGAGCAGCG
CGGATCCTCGATCGCGCAGTTCTTCGCGATCCAGTCGATGAAGCTCGATCCGGACAATCTGACCTCGGAC
GTGACGGGCGACCTGCACACGATCGTAGGGAGCAAGGTCGTCTCCAAGGACCGCCGGACCTTCCGCTTCA
AATGGAAATATTCGGGCGTCTCGCTGCAGCTCGTCGGCTTCGGGATGGTGTCCAAAGCCGAGGAAGGAGA
TCAATGA
 Primer design