SecReT4
Protein ID: 148550804
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5368
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]274228..275559 [+]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA5VGR0
KEGG IDswi:Swit_5368
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.8e-33, Aligned region: 233..440
Protein Sequence: 443 a.a.     [Download]
>gi|148550804|ref|YP_001260243.1| TraB pilus assembly family protein [Sphingomonas wittichii RW1]
MALADIFSRTRRTLDGPDEETENVSPVTGEIGSNEATRKKQRLLLAGVAGAGLVLSSFWIFGGNDKDAAE
DDDGEKVEVSTKDLVNRNLSQQEWMGMSENQFQSMENQLKSVNAQQNRVDALAAQVEALKGQNQALQADG
QRVFSAYQAENERLKREAAQQRAAPPPQPGPAALYGPGGTQAYRRPDGTPGAAGPAGAPMGGAEVKMVNF
QTAETGNASRVAKGNTVYTDSVNYLPPNSFASAKVIVGVDASAGVNSQSDPLPVVLRVTGPARSVFQNGR
LLTTKIEGCLINGAARGDLSAEKVYVKLQKMTCPQPGGRYAVSEVKGFIAFGGKTGVRGRVVSREGGLVT
QAFIAGLFGGFGRGFSANANSVFQGTNITTNGKREKLSAGEILEGGFGEGVAQTGDMVSKYLIERAEQYQ
PVIEMPTGIDVEIVFLEGVYVRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|148550551|ref|NC_009507.1|:274228-275559 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGCACTCGCGGACATTTTCTCGCGCACCCGTCGCACCCTGGACGGTCCCGACGAAGAAACCGAGAATG
TTTCACCGGTAACCGGCGAAATCGGCAGCAACGAGGCGACGCGCAAGAAGCAGCGGTTGCTGCTCGCGGG
CGTTGCCGGCGCGGGGCTGGTGCTCTCCTCCTTCTGGATATTCGGGGGCAACGACAAGGACGCGGCTGAA
GACGACGACGGTGAAAAGGTCGAGGTGTCGACCAAGGATCTGGTGAACCGCAACCTCTCCCAACAGGAGT
GGATGGGGATGTCCGAGAACCAGTTCCAGTCGATGGAAAACCAGCTGAAGTCGGTGAATGCGCAGCAGAA
CCGCGTCGACGCGCTGGCAGCCCAGGTCGAAGCGCTGAAAGGACAGAACCAGGCCCTTCAGGCTGATGGC
CAGCGGGTCTTCTCCGCCTACCAGGCCGAGAACGAACGGCTCAAGCGTGAGGCGGCGCAGCAGCGGGCGG
CACCGCCGCCCCAGCCAGGTCCAGCCGCGCTCTACGGCCCGGGCGGGACCCAGGCCTATCGGCGGCCCGA
TGGCACGCCGGGGGCAGCCGGGCCCGCCGGCGCGCCGATGGGCGGAGCGGAAGTCAAGATGGTGAACTTC
CAGACCGCCGAGACCGGCAATGCCTCGCGCGTCGCCAAGGGCAACACGGTCTACACCGACAGCGTCAACT
ACCTGCCGCCCAACAGCTTCGCGTCCGCCAAGGTGATCGTCGGCGTCGATGCCAGTGCCGGCGTCAACAG
CCAGTCCGATCCGCTTCCGGTCGTGCTGCGCGTGACGGGCCCTGCGCGCAGCGTCTTCCAGAACGGGCGC
CTGCTCACCACCAAGATCGAGGGCTGCCTCATCAACGGGGCGGCGCGCGGCGACCTTTCGGCCGAGAAGG
TCTACGTCAAACTGCAGAAGATGACCTGTCCGCAGCCCGGCGGCCGCTATGCGGTCTCGGAGGTCAAGGG
CTTCATCGCCTTCGGCGGCAAGACCGGGGTGCGCGGCCGGGTGGTCTCGCGCGAAGGCGGGCTGGTGACG
CAGGCCTTCATTGCCGGCCTCTTCGGTGGCTTTGGCCGCGGTTTCTCCGCAAATGCCAATTCGGTGTTCC
AGGGCACCAACATAACCACAAACGGCAAGCGCGAAAAACTCTCGGCGGGCGAGATCCTGGAGGGTGGCTT
CGGGGAAGGCGTCGCCCAGACCGGCGACATGGTCTCGAAATATCTGATCGAGCGCGCCGAACAGTATCAG
CCGGTGATCGAGATGCCGACCGGCATCGATGTCGAAATCGTCTTCTTGGAGGGTGTCTATGTCCGTAACT
GA
 Primer design