SecReT4
Protein ID: 148550806
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5370
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]276403..277416 [+]
ProductType IV conjugative transfer system protein TraV
Component typeTraV_F
UniProt IDA5VGR2
KEGG IDswi:Swit_5370
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 8.7e-16, Aligned region: 39..144
Protein Sequence: 337 a.a.     [Download]
>gi|148550806|ref|YP_001260245.1| Type IV conjugative transfer system protein TraV [Sphingomonas wittichii RW1]
MAEGSQVVKGRATHWHAGLALAVLPLMGGCASFGSNIAGSFSCPAPDGICAPSSSIDDRALALITAEAPD
AVPSPAGPYRDPDMGAGKGARTAVASPRRMPVSIGEAGRTREKVLRIVFQPYIDERGRLHEASAVHAVVA
QGEWQQQAIADASGLSSRDERAAAYAGETLADAVDRAETQRLSSAEGLPDPAAVAAARARVTADPVASIK
SDVAARLTPRPDARARRKVAATPAQPGSAPVSPTAPTAPSSATAAPPARAVPSAPPAAAVPAAPTKTTAG
AEAAARVKADSRYQAVASQAQDGARAAATGAQAPDLRPVLKPTVSSAPFPGAVAEEN
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|148550551|ref|NC_009507.1|:276403-277416 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGCTGAAGGGAGCCAAGTCGTGAAGGGCCGCGCCACGCACTGGCATGCTGGCCTGGCGCTCGCCGTCC
TGCCGCTTATGGGGGGCTGCGCATCGTTCGGCAGCAATATCGCGGGCAGTTTTTCCTGCCCTGCGCCGGA
CGGAATTTGCGCGCCGTCGTCATCGATCGACGACCGGGCATTGGCCCTCATCACGGCTGAAGCGCCGGAC
GCCGTGCCGTCACCGGCGGGACCCTATCGCGATCCCGACATGGGAGCGGGAAAAGGCGCCCGGACGGCGG
TGGCAAGCCCGCGGCGCATGCCGGTGTCGATCGGAGAGGCGGGCCGCACGCGTGAGAAAGTGCTGCGGAT
CGTCTTCCAGCCTTATATCGACGAGCGCGGCCGGCTGCACGAGGCGAGTGCCGTCCATGCCGTGGTTGCG
CAGGGCGAGTGGCAGCAGCAGGCTATCGCGGACGCGTCTGGCCTCTCCTCCCGCGATGAGCGCGCGGCGG
CCTATGCGGGCGAGACGCTCGCCGACGCGGTCGATCGCGCCGAGACGCAGCGCCTCTCCTCTGCCGAAGG
CCTGCCTGACCCGGCGGCTGTCGCTGCCGCGCGGGCGCGCGTGACGGCGGATCCGGTTGCCAGCATCAAG
AGCGATGTCGCGGCCCGGTTGACGCCACGGCCGGATGCGCGGGCGCGGCGCAAGGTCGCGGCAACGCCAG
CGCAACCCGGGAGCGCCCCGGTTTCGCCCACCGCGCCGACTGCTCCTTCCTCAGCAACGGCTGCGCCGCC
GGCGCGTGCGGTCCCGTCGGCTCCGCCGGCTGCGGCAGTCCCTGCCGCTCCTACCAAGACGACCGCTGGC
GCGGAAGCGGCGGCGCGGGTGAAAGCCGATAGCCGGTACCAGGCGGTGGCGTCGCAGGCACAGGATGGTG
CGCGGGCAGCGGCCACGGGCGCGCAGGCGCCCGATCTGCGGCCGGTGCTCAAGCCCACGGTGAGTTCGGC
CCCATTCCCCGGCGCTGTCGCGGAGGAGAACTGA
 Primer design