SecReT4
Protein ID: 148550807
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5371
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]277418..280012 [+]
ProductType-IV secretion system protein TraC
Component typeTraC_F
UniProt IDA5VGR3
KEGG IDswi:Swit_5371
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.3e-64, Aligned region: 31..278
AAA_10 [PF12846], Evalue: 1.1e-51, Aligned region: 476..761
FtsK_SpoIIIE [PF01580], Evalue: 1.1e-05, Aligned region: 459..511
DUF87 [PF01935], Evalue: 5.2e-05, Aligned region: 478..511
Protein Sequence: 864 a.a.     [Download]
>gi|148550807|ref|YP_001260246.1| Type-IV secretion system protein TraC [Sphingomonas wittichii RW1]
MAKGGFFDSMLSGLFGDAARPDDDRPALGVPMLAHWLPYRSYDPKTGIFYNSASRGFVIEAAPMVGADER
TAEIITQFLSEGIPAPGCIQFHQWMSPRVGEALSKWYLPRYAARGVYERMAKHRVDFLSDGVWQSLSKDA
PFCLRHHRVAISYSTPESSSVSDDDIVSVMEGLVSALASVGITTRRMDPVALIAWIDDITSPTTAAGEDV
VSYNPFDPIADQAIRRDIELRVEPDRMLLRTERFRPTGKVHEGAPEIGEIYPDVFDVRSFSVRNLPNRWA
PWDMAKLVGDMFTDKLRMPCPVATNLCVEYPDTQASSNKASFKFMRTTSLADSKSARFLPQLRDQSQEWR
FVNDEIRQGRKLVRVFFSVTSFSPKGRGDANERVLKSVYRAAGWDLLDDRYLQVMGLLCAMPMTMANGLS
RDLERMKRMRTLLTTTAANLAPLQGEYLGGHVPHLLMVGRRGQPFFWSPFENAAGNHNVAVFGKSGSGKS
VALQELCASLCGAGAKVVVIDDGRSFEHSAKLQGGAFVEFTMSSGFCLNPFSMIDEAQAAEDEDYLLDCM
AMLKAIVNQMSRHIDRLNDTERGLIDGAVNTVWEAHGRRGSIDLVIEALDATGNALAHDLGIAMRPFSAA
GTYGRFFQGEVSFELKAQLTVFELSDLSAREELRSVVLTAIMFMSQQVMRKVDRAIPKALLLDEAWQLLR
GGAMADFIETYARTCRKYGASLVTATQSLNDYYKSAGSIAALENSDWFVILQQKPETIADFKKHDRFEMD
DYTDALLRSLKRNGFEYSDIMIKGPETLAVGRLVLDPYSATLFSSSPQTFARIEALIGEGLSMDEAIERI
AFPDNPEKWAANAESDPDVAIAAE
 
Nucleotide Sequence: 2595 bp     [Download]
>gi|148550551|ref|NC_009507.1|:277418-280012 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGCGAAAGGCGGCTTTTTCGACAGCATGCTTTCGGGGCTCTTCGGCGATGCCGCGCGCCCTGATGATG
ACCGGCCCGCGCTTGGCGTTCCCATGCTGGCGCACTGGCTGCCCTATCGCAGCTACGATCCCAAGACGGG
GATCTTCTACAACAGCGCCTCGCGCGGATTCGTGATCGAGGCCGCTCCGATGGTGGGCGCGGACGAGCGC
ACCGCGGAGATCATCACGCAGTTCCTGTCCGAAGGCATTCCCGCGCCGGGCTGCATCCAGTTCCATCAGT
GGATGAGCCCGCGCGTGGGGGAGGCGCTGAGCAAATGGTATCTGCCGCGCTATGCCGCACGCGGCGTCTA
CGAACGGATGGCCAAGCACCGGGTCGATTTCCTCAGCGACGGCGTATGGCAGTCGCTCTCGAAGGACGCG
CCCTTTTGCCTGCGCCATCACCGCGTGGCGATCTCCTATTCGACGCCCGAGAGCTCGTCGGTGTCCGATG
ACGACATCGTCTCGGTCATGGAGGGGCTCGTCTCCGCGCTGGCTTCGGTGGGGATCACGACCCGGCGCAT
GGATCCGGTCGCGCTGATCGCCTGGATCGACGACATCACTTCACCGACCACGGCTGCCGGTGAGGACGTC
GTCAGCTACAATCCCTTCGATCCAATCGCCGACCAGGCCATTCGCCGCGACATCGAGCTCCGGGTCGAAC
CCGACCGGATGCTGCTGCGCACCGAGCGGTTCCGACCGACCGGCAAGGTCCACGAAGGCGCCCCGGAGAT
CGGCGAGATCTATCCCGATGTCTTTGACGTGCGCTCCTTCTCGGTGCGCAACCTGCCCAATCGCTGGGCG
CCCTGGGACATGGCGAAGCTGGTGGGCGACATGTTCACTGACAAGCTGCGCATGCCGTGCCCGGTCGCGA
CGAACCTGTGCGTTGAATATCCGGACACCCAGGCCTCGTCGAACAAGGCGAGCTTCAAGTTCATGCGGAC
GACGAGTCTCGCCGATTCCAAGTCCGCGCGTTTCCTGCCGCAGCTGCGCGACCAGAGCCAGGAGTGGCGG
TTCGTCAACGACGAGATCCGGCAGGGCCGCAAACTTGTGCGGGTATTCTTTTCCGTCACCTCCTTCTCGC
CCAAGGGACGCGGCGACGCCAACGAACGTGTGCTCAAATCCGTCTACCGCGCGGCGGGCTGGGACCTGCT
CGACGACCGCTACCTGCAGGTGATGGGCCTGCTCTGCGCCATGCCCATGACGATGGCCAACGGCCTGTCG
CGCGATCTCGAGCGGATGAAGCGCATGCGCACGCTGCTCACCACCACCGCCGCCAATCTCGCGCCGCTGC
AGGGCGAATATCTAGGCGGCCATGTGCCGCATCTCCTGATGGTGGGACGGCGCGGCCAGCCCTTCTTCTG
GTCACCCTTCGAAAACGCGGCGGGCAACCATAATGTCGCGGTCTTCGGCAAATCGGGATCGGGCAAGTCG
GTGGCCTTGCAGGAGCTGTGCGCCTCGCTGTGCGGCGCTGGCGCAAAGGTGGTCGTGATCGACGACGGGC
GATCGTTCGAGCATTCGGCCAAATTGCAGGGCGGCGCCTTCGTCGAATTCACCATGAGCTCGGGCTTCTG
CCTTAATCCCTTCTCGATGATCGACGAGGCCCAGGCGGCTGAGGACGAGGACTATCTGCTCGACTGCATG
GCGATGCTCAAGGCCATCGTGAACCAGATGTCGCGCCACATCGACCGTCTCAACGATACCGAGCGCGGCC
TCATCGATGGCGCGGTCAACACGGTGTGGGAGGCACACGGCCGAAGAGGATCGATCGACCTTGTGATCGA
GGCGCTCGATGCAACCGGCAACGCGCTCGCGCACGACCTCGGTATTGCGATGCGCCCCTTCTCGGCGGCG
GGCACCTATGGCCGGTTCTTCCAGGGGGAGGTCAGCTTCGAACTGAAGGCGCAGCTCACGGTCTTCGAGC
TCTCGGATCTCTCCGCGCGCGAAGAACTGCGCAGCGTGGTCCTCACCGCCATCATGTTCATGTCGCAGCA
GGTGATGCGCAAGGTCGATCGCGCAATCCCCAAGGCACTGCTGCTGGATGAAGCCTGGCAGCTGCTGCGC
GGCGGGGCTATGGCCGACTTCATCGAGACCTATGCGCGCACCTGCCGCAAATATGGCGCTTCGCTCGTCA
CCGCCACGCAGTCGCTCAACGATTATTACAAGTCGGCGGGTTCGATCGCGGCGCTGGAGAACAGCGACTG
GTTCGTCATCCTGCAGCAGAAGCCGGAAACGATCGCCGACTTCAAGAAGCATGATCGCTTCGAGATGGAC
GATTATACCGATGCGCTGCTGCGCTCCTTGAAGCGTAACGGCTTCGAATATTCGGACATCATGATCAAGG
GACCCGAGACGCTGGCGGTTGGTCGCCTGGTTCTGGATCCCTATTCAGCCACATTGTTTTCCTCGAGCCC
GCAGACCTTCGCCCGGATCGAGGCGCTGATCGGAGAGGGTCTCAGCATGGACGAGGCGATCGAGCGCATC
GCCTTTCCCGACAACCCCGAGAAATGGGCGGCGAACGCGGAGAGTGATCCCGACGTCGCAATCGCCGCGG
AGTAG
 Primer design