SecReT4
Protein ID: 148550811
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5375
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]281573..282226 [+]
ProductType-F conjugative transfer system protein TraW
Component typeTraW_F
UniProt IDA5VGR7
KEGG IDswi:Swit_5375
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 217 a.a.     [Download]
>gi|148550811|ref|YP_001260250.1| Type-F conjugative transfer system protein TraW [Sphingomonas wittichii RW1]
MTRTILLAATTACLGGATLFLVGSASEARDYGTAGQAFPIIEPDLLATIEARLRHAEASGELARTNALFA
KRVEAKVRRPDPVAGISPAQETRSWDFDPSVRIDHDVRDQKGNMIAKAGQKVNPLDFVGIHQDLVFVDGD
NAEQLDWACGKYSDVKAKIIFVKGSPIEAMSQRKRRFYFDQEGKLTGRFGIEHTPAVVSQAGRVMRVTEH
ALKGRAG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|148550551|ref|NC_009507.1|:281573-282226 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGACGCGCACCATCCTGCTGGCGGCGACAACCGCATGCCTGGGCGGCGCGACCCTGTTTCTTGTCGGCT
CCGCCAGCGAGGCGCGCGATTATGGAACGGCAGGGCAGGCCTTTCCGATCATCGAGCCTGACCTGCTTGC
GACGATCGAGGCGCGGCTGCGCCATGCCGAAGCGAGCGGCGAACTGGCGCGAACCAATGCGCTCTTCGCC
AAGCGGGTTGAGGCCAAGGTCCGGCGGCCTGATCCCGTCGCCGGTATCTCGCCGGCCCAGGAGACGCGCA
GCTGGGATTTCGATCCCTCGGTTCGCATCGACCATGATGTCCGCGACCAAAAGGGGAATATGATCGCAAA
GGCCGGTCAGAAGGTGAACCCGCTCGATTTCGTCGGCATTCATCAGGATCTTGTCTTTGTCGATGGGGAC
AATGCCGAGCAGCTGGACTGGGCCTGCGGCAAATATAGCGACGTGAAGGCGAAGATCATCTTCGTGAAGG
GATCGCCGATCGAGGCGATGTCGCAGCGCAAGCGGCGCTTCTATTTCGACCAGGAGGGCAAGCTCACCGG
TCGCTTCGGCATCGAGCACACGCCCGCCGTCGTCAGCCAGGCGGGCCGTGTGATGCGGGTCACCGAACAT
GCGCTCAAGGGGAGGGCGGGCTGA
 Primer design