SecReT4
Protein ID: 148550813
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5377
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]282495..283517 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDA5VGR9
KEGG IDswi:Swit_5377
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.8e-82, Aligned region: 34..339
Protein Sequence: 340 a.a.     [Download]
>gi|148550813|ref|YP_001260252.1| TraU family protein [Sphingomonas wittichii RW1]
MTRGLRSLLGALSLLVTLMLFAAPAQAAGPTCNGKFVNPITDVCWSCLFPLSVGGLKIWPSGRPDTSNPA
SPVCACADPLPRIGIAVGFWEPARLADVTMKPWCFPNLGGIRIAPGFDIGQGYLAGPSMVGGRSQSTAKW
HVHWYVYPLLYWMEILTDFVCFEQASFDIAYMTEIDPLWQDDALTTLINPEAIIFANPIAQAACAGDCIA
GTVNLPLDPLFWCAGCQGSMYPLNGNVPASIGHVQSSRLAVSRFAYKMHREALAWGTMGSKGLCKKYLMP
IMRKQQYRFQMVNPIPTVSGRFACSAIGASTMPPDAGRAYPAGGEDMGYLVWRKRNCCVL
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|148550551|ref|NC_009507.1|:282495-283517 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGACGCGCGGTCTTCGATCCCTGCTCGGCGCTCTGTCGCTTCTCGTGACGCTAATGCTTTTTGCAGCGC
CAGCGCAGGCGGCCGGACCGACCTGCAACGGCAAGTTCGTCAATCCGATCACCGACGTCTGCTGGTCGTG
CCTCTTTCCCTTGTCGGTGGGCGGCCTCAAGATCTGGCCGAGCGGCCGGCCCGATACCAGCAATCCCGCC
TCGCCGGTCTGCGCCTGCGCGGATCCGTTGCCGCGCATCGGCATTGCCGTCGGTTTCTGGGAGCCGGCTC
GCCTCGCTGACGTGACGATGAAGCCGTGGTGCTTCCCCAACCTGGGGGGCATCCGCATCGCCCCGGGGTT
CGATATCGGGCAAGGCTATCTCGCCGGTCCCTCGATGGTCGGCGGGCGGTCGCAAAGCACGGCCAAGTGG
CATGTGCACTGGTATGTCTATCCGCTGCTCTACTGGATGGAGATCCTGACCGACTTCGTCTGCTTCGAGC
AGGCGAGCTTCGACATCGCCTATATGACCGAGATCGATCCGCTCTGGCAGGACGATGCTCTCACCACGCT
GATCAACCCGGAAGCGATCATCTTCGCCAATCCGATCGCTCAGGCCGCCTGCGCGGGTGACTGCATTGCC
GGCACGGTCAACCTACCGCTCGATCCGCTCTTCTGGTGCGCGGGCTGCCAGGGTTCGATGTACCCGCTCA
ACGGCAATGTCCCGGCCTCGATCGGCCATGTGCAGTCGTCGCGGCTGGCGGTTTCCCGCTTCGCCTACAA
GATGCACCGCGAGGCGCTGGCCTGGGGGACGATGGGCTCGAAGGGCCTGTGCAAGAAGTACCTCATGCCG
ATTATGCGAAAGCAGCAATATCGCTTCCAGATGGTCAATCCGATCCCGACGGTGAGCGGGCGGTTCGCCT
GCTCCGCGATCGGGGCTTCCACGATGCCGCCCGACGCGGGTCGCGCCTATCCCGCCGGCGGCGAGGACAT
GGGCTACCTCGTCTGGCGCAAGCGCAACTGTTGTGTCCTGTAG
 Primer design