SecReT4
Protein ID: 148550814
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5378
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]283528..284271 [+]
Producttype-F conjugative transfer system pilin assembly protein TrbC
Component typeTrbC_F
UniProt IDA5VGS0
KEGG IDswi:Swit_5378
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 5.5e-33, Aligned region: 113..225
Protein Sequence: 247 a.a.     [Download]
>gi|148550814|ref|YP_001260253.1| type-F conjugative transfer system pilin assembly protein TrbC [Sphingomonas wittichii RW1]
MRFAAWGVAALLATAGVSALLAQTVDGLDVQAIKKRSADLAADAEAFVNHVKDRGDQFREEAVAVREAGT
ENMRQVAAKDLPKGPDGAIDFDEIVQGAAGNASVKSGEAPQFIVFASLSMPPQSLKPLIRDTARAGGVVV
FRGFPNNSMKEFATRLGQIVERQDEFANVGIDPRLFRAFNVQAVPTYVAVSSDFDLCAGFSCQTKVPPYD
RMTGNVTVEYALSSFADGYGPGARVAAVGLSNMRMQR
 
Nucleotide Sequence: 744 bp     [Download]
>gi|148550551|ref|NC_009507.1|:283528-284271 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGCGTTTCGCTGCCTGGGGCGTTGCTGCCCTGCTTGCTACCGCCGGTGTATCGGCGCTGCTCGCCCAGA
CCGTTGACGGTCTCGACGTGCAGGCCATCAAAAAGCGCTCGGCCGACCTTGCCGCGGATGCCGAAGCCTT
CGTGAACCACGTCAAGGATCGCGGCGACCAGTTCCGCGAGGAGGCCGTCGCGGTGCGCGAAGCCGGCACT
GAAAACATGCGACAGGTCGCGGCCAAGGATCTGCCCAAGGGGCCCGACGGCGCGATCGACTTCGATGAGA
TCGTGCAAGGCGCCGCCGGTAATGCCAGCGTCAAGAGTGGCGAGGCGCCGCAATTCATCGTCTTTGCCAG
CCTCTCGATGCCGCCGCAGTCCCTGAAGCCGCTTATCCGCGATACGGCGCGCGCGGGCGGCGTCGTGGTG
TTCCGCGGCTTTCCGAACAACAGCATGAAGGAGTTTGCGACCCGGCTCGGGCAGATCGTCGAGCGCCAGG
ACGAATTCGCCAATGTCGGCATCGATCCGCGACTGTTCCGAGCCTTCAATGTGCAGGCGGTCCCGACCTA
TGTTGCCGTGTCGTCCGATTTCGACCTGTGCGCCGGCTTTTCCTGCCAGACAAAGGTGCCGCCCTATGAC
CGCATGACGGGCAATGTCACCGTGGAATATGCGCTCAGCAGCTTTGCCGACGGCTATGGTCCGGGCGCCC
GGGTCGCCGCCGTTGGCCTCTCAAATATGCGGATGCAGCGCTGA
 Primer design