SecReT4
Protein ID: 148550815
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5379
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]284271..286133 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA5VGS1
KEGG IDswi:Swit_5379
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 8.9e-73, Aligned region: 300..570
Protein Sequence: 620 a.a.     [Download]
>gi|148550815|ref|YP_001260254.1| conjugal transfer mating pair stabilization protein TraN [Sphingomonas wittichii RW1]
MRLALAISLAVLAGASFPAQAQTTLEEAREQGKAMGAAAKANPVLVPSDNAQAEAVPGFSGTTLPQGSYF
DDPDKLINDAQALKSSSEQYQITTDSSHVRPTFSNAEILSTTNRATTIEEDPSTYLAGEAYGGTSGSCTA
LPPGSGTSGYYEASCNAGAKVTTNARSCTVNLDVRTEKRTIYTYYAGRLSFLPSDGGPYPARAAFDDEIA
SGVCWESRPIDYCDNMAAYGYTAADTCKSLGHTAVEVKCSAEAQGITQGAYHPGTVISTGNYWLTRQEEP
AVPVITRNEGFCAAYTGDSNCTLESEICTASDPVTRIVDGVPVTQPCWAWQRSYQCHTISSANDCSELEA
NGSCTYQRTECLDEDPDGGPCKVQEKIYRCPTPSGTSADAPQYICGNDVYCINGDCEPIERQASTEFKDA
LVALHSIDQAGKEFDETNYRVFSGTRETCHKPVFGLINCCAGKVSGLVPVAAGAAALAGGPAAIAAFATP
FLVLFACSQDEMRLDIKDRMGFCHKLGTYCSSSFLGICKTKRTAYCCFESKLSRILQEQGRVQLGKPWGA
PKKEQCQGFTIEEFASLDLSVMDFTEIYSDFLDAAKLPDEVQTMTDIQSKIQDYYDLHGK
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|148550551|ref|NC_009507.1|:284271-286133 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGCGCCTCGCGCTCGCAATCAGTCTCGCGGTCCTGGCCGGGGCCAGCTTCCCCGCGCAGGCGCAGACCA
CGCTGGAGGAAGCGCGCGAGCAGGGAAAGGCGATGGGAGCCGCGGCCAAGGCCAATCCGGTCCTGGTGCC
CAGCGACAACGCGCAGGCGGAAGCCGTGCCGGGGTTCTCTGGGACGACCCTCCCGCAGGGCAGCTATTTC
GATGATCCGGACAAGCTGATCAACGATGCACAAGCGCTCAAGTCGAGCAGCGAGCAGTACCAGATCACGA
CCGACAGCAGCCATGTGCGCCCGACCTTCAGCAATGCCGAGATCCTCTCGACGACTAATCGAGCGACCAC
CATTGAGGAGGATCCCTCCACCTATCTGGCGGGCGAGGCTTACGGCGGGACGAGCGGAAGCTGCACCGCG
CTTCCGCCTGGATCGGGCACGAGCGGCTATTATGAGGCGAGTTGCAACGCGGGCGCCAAGGTAACGACCA
ACGCCCGCAGTTGCACCGTCAACCTGGATGTGCGCACCGAGAAGCGCACGATCTACACTTATTATGCGGG
ACGTTTGAGTTTCCTGCCGAGCGATGGCGGCCCCTATCCGGCCCGTGCCGCGTTCGACGATGAAATCGCT
TCGGGAGTCTGCTGGGAAAGCCGACCCATCGACTATTGCGACAATATGGCTGCCTATGGCTATACGGCGG
CCGACACCTGCAAGAGCCTGGGTCACACGGCCGTCGAGGTGAAGTGCAGCGCTGAAGCGCAAGGGATTAC
GCAAGGCGCCTATCACCCCGGCACGGTGATTTCGACCGGCAACTACTGGCTGACCAGGCAGGAGGAACCG
GCGGTTCCCGTCATCACCCGCAACGAGGGTTTCTGCGCGGCCTATACCGGCGACAGCAACTGCACGCTGG
AATCGGAGATCTGCACGGCAAGCGATCCGGTTACCCGGATCGTCGATGGCGTGCCTGTCACGCAGCCGTG
CTGGGCGTGGCAGCGCAGCTACCAGTGCCACACCATTTCGTCGGCCAACGACTGCTCGGAACTCGAAGCC
AATGGCAGTTGCACCTATCAGCGCACCGAATGCCTGGACGAGGATCCTGACGGCGGACCCTGCAAGGTCC
AGGAGAAGATCTATCGCTGCCCGACGCCGTCGGGCACCTCGGCCGACGCCCCGCAATATATCTGCGGCAA
CGACGTCTATTGCATCAACGGCGACTGCGAGCCGATCGAACGGCAGGCTTCGACCGAATTCAAGGACGCG
CTGGTGGCGCTGCACTCGATCGACCAGGCCGGCAAGGAGTTCGACGAAACCAATTACCGGGTGTTTTCGG
GCACACGCGAGACCTGCCATAAGCCGGTATTTGGCCTCATCAACTGCTGTGCCGGCAAGGTTTCGGGATT
GGTGCCGGTAGCGGCGGGGGCGGCCGCTCTGGCGGGCGGGCCGGCTGCGATCGCGGCCTTCGCCACGCCG
TTCCTCGTGTTGTTCGCCTGTTCTCAGGACGAGATGAGGCTCGATATCAAGGACCGGATGGGCTTTTGCC
ACAAACTGGGCACCTACTGCTCATCGAGTTTCCTGGGCATCTGCAAGACCAAGCGCACGGCCTATTGCTG
CTTTGAAAGCAAGCTTTCGCGGATCCTGCAGGAGCAGGGCCGGGTGCAGTTGGGAAAGCCCTGGGGGGCG
CCCAAGAAGGAGCAGTGCCAGGGTTTCACGATCGAGGAATTCGCCTCGCTCGACCTTTCGGTGATGGATT
TCACCGAAATCTATTCGGACTTCCTGGATGCAGCAAAGCTTCCCGACGAAGTCCAGACGATGACGGACAT
TCAGTCGAAGATACAGGATTACTATGATCTCCACGGCAAATGA
 Primer design