SecReT4
Protein ID: 148550817
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5381
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]286722..287537 [+]
ProductTraF-like protein
Component typeTraF_F
UniProt IDA5VGS3
KEGG IDswi:Swit_5381
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.1e-74, Aligned region: 47..260
Protein Sequence: 271 a.a.     [Download]
>gi|148550817|ref|YP_001260256.1| TraF-like protein [Sphingomonas wittichii RW1]
MSKFTRICAVVLALMPMAVDAQEAGAGRDTIDGQSPDDFYCGERRLGQWFYCSKPKPRETRPASPQAPEP
SAAERMAAIAKELDELKARAILDPSEENVIAYVRFQREQLDRASTFADTWQRALWQHPDIDYTLQRPVST
VGKRAWLDNRKADRDAVLTSLGQRYGLFYFYAQSCGACELFAPILRSVADSHRMAVMAVSMDGGPNKEFP
NYVVDTGQRARMGLTGNETPALVLFDTQTKRTIPVGYGILSADEIMDRIFMLTNTKVGSDY
 
Nucleotide Sequence: 816 bp     [Download]
>gi|148550551|ref|NC_009507.1|:286722-287537 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGTCGAAGTTCACTAGGATTTGCGCAGTGGTTCTGGCGCTGATGCCCATGGCTGTTGACGCGCAGGAGG
CAGGGGCAGGCCGCGACACGATCGACGGGCAATCGCCCGACGACTTCTATTGTGGCGAGCGCCGCCTGGG
GCAATGGTTCTATTGCTCGAAACCCAAGCCGCGCGAGACCCGCCCAGCGTCGCCGCAGGCGCCCGAGCCC
TCGGCTGCCGAACGCATGGCCGCGATTGCGAAGGAGCTCGATGAGCTCAAGGCCCGCGCGATCCTTGACC
CCTCCGAAGAGAATGTCATCGCCTATGTGCGCTTCCAGCGCGAGCAGCTCGACCGGGCCTCGACTTTCGC
CGATACGTGGCAGCGCGCTCTCTGGCAGCATCCCGACATCGACTACACGCTGCAGCGTCCGGTTTCGACG
GTCGGCAAACGGGCCTGGCTCGACAATCGCAAGGCGGATCGGGATGCTGTCCTGACGAGCCTCGGCCAGC
GCTACGGGCTTTTCTATTTCTATGCGCAAAGCTGCGGCGCCTGCGAGCTCTTCGCGCCGATCCTGCGCTC
GGTCGCCGACAGCCATCGGATGGCGGTCATGGCGGTCTCGATGGATGGTGGCCCGAACAAGGAATTTCCC
AACTATGTCGTCGACACGGGCCAGCGTGCCCGCATGGGACTGACCGGCAACGAGACGCCGGCGCTGGTCC
TGTTCGACACCCAGACGAAGCGGACGATCCCGGTCGGGTACGGCATCCTCAGCGCCGATGAGATCATGGA
CCGGATCTTCATGCTCACCAACACCAAGGTGGGGAGTGACTACTGA
 Primer design