SecReT4
Protein ID: 148550818
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5382
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]287537..289000 [+]
ProductTraH family protein
Component typeTraH_F
UniProt IDA5VGS4
KEGG IDswi:Swit_5382
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 3.7e-121, Aligned region: 42..402
Protein Sequence: 487 a.a.     [Download]
>gi|148550818|ref|YP_001260257.1| TraH family protein [Sphingomonas wittichii RW1]
MARKSSGRARAAIRRLAHGAAILAASHFALVGVAHADVAGQMNSFFNDAGGAANVTGPSAFQGQSAGYYS
MGNVWTRFPQKSVSPFNLQLPSARAGCGGIDLFSGSFSFINASEIVAMLKATANNALGFAFKLAIDSVSP
EIGKVMDEFSQKAQLLNQMNISSCETAQALVGGIWPQMDTTRSTICEAIGNSQGIFSDWAASRQGCNNGN
QRDNTIAGNSDASMKDQLVGEPHNYTWEALKKAGKFGAFDQSFSEFIMTLVGTVITKPSDDPSVGGKVVM
IGPAEDAVVTALLDGTADAPPVKLLKCNDENCYEVGEQTLSVPASSALRPRIEALIQSMNDKIRSDTPLD
AAEKQLLNIATVPIFKILSVQAYAHYSLSPGEIQAMSEIVAVDLLTAMLDNMMDRVEQSQVHYQTFDQAT
AAQWKAQIAAARAKYAQRDVKLNNKLQVTMQLINRSMMLESTLQNSMTPGMASALTFSRGLSSQGLN
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|148550551|ref|NC_009507.1|:287537-289000 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGGCACGCAAGAGTTCCGGACGGGCACGGGCGGCGATCCGGCGCCTCGCTCATGGCGCCGCCATATTGG
CGGCATCGCATTTCGCGCTGGTGGGCGTTGCCCATGCCGATGTCGCGGGCCAGATGAACAGCTTCTTCAA
CGACGCGGGCGGTGCGGCCAATGTGACGGGCCCAAGCGCCTTCCAGGGCCAGTCGGCCGGCTACTATTCG
ATGGGCAACGTCTGGACGCGCTTCCCGCAGAAATCGGTGTCGCCGTTCAACCTGCAGTTGCCCAGTGCCC
GGGCGGGCTGCGGCGGCATCGACCTCTTTTCCGGGTCCTTCTCCTTCATCAATGCCTCCGAGATCGTGGC
GATGCTCAAGGCCACCGCCAACAACGCACTTGGCTTTGCCTTCAAGCTCGCGATTGATTCCGTATCTCCG
GAAATCGGCAAGGTGATGGACGAGTTCAGCCAGAAGGCGCAGCTCCTCAACCAGATGAACATCTCGAGCT
GCGAGACCGCGCAGGCGCTGGTTGGCGGCATCTGGCCGCAGATGGACACCACCCGCTCGACCATCTGCGA
AGCCATCGGCAACAGCCAGGGCATATTCTCGGACTGGGCCGCCTCACGGCAGGGCTGCAACAACGGCAAC
CAGCGCGATAACACGATCGCCGGAAACAGCGATGCGTCGATGAAGGACCAGCTTGTCGGCGAGCCGCATA
ACTATACCTGGGAGGCCTTGAAGAAGGCAGGCAAGTTCGGCGCGTTCGACCAGAGCTTCTCCGAATTCAT
CATGACCCTGGTCGGCACGGTAATCACGAAGCCGTCGGACGATCCGAGTGTCGGCGGCAAGGTCGTGATG
ATCGGCCCGGCCGAAGACGCCGTGGTAACCGCGCTTCTGGATGGTACGGCCGATGCGCCGCCGGTGAAGC
TCCTCAAATGCAACGACGAGAACTGCTACGAGGTCGGCGAGCAGACGCTGTCGGTGCCAGCATCGTCCGC
GTTACGCCCGCGGATCGAAGCGCTGATCCAGTCGATGAACGACAAGATCCGCAGCGATACGCCACTCGAT
GCCGCGGAAAAGCAGCTTCTGAACATCGCGACGGTGCCGATTTTCAAGATCCTGAGCGTCCAGGCTTATG
CGCATTACTCGCTGTCGCCCGGCGAGATCCAGGCAATGTCAGAGATCGTCGCGGTCGACCTGTTGACCGC
TATGCTCGACAATATGATGGACCGGGTCGAGCAAAGCCAGGTTCATTACCAGACCTTCGACCAGGCTACC
GCGGCCCAGTGGAAGGCGCAGATCGCCGCTGCCCGCGCTAAATACGCGCAGCGCGACGTCAAGCTCAACA
ACAAGCTGCAGGTCACGATGCAGCTCATCAACCGCAGCATGATGCTCGAGTCCACCCTGCAGAATTCGAT
GACGCCGGGCATGGCTTCGGCGCTGACCTTCTCGCGCGGGCTGAGCTCGCAGGGGCTGAACTGA
 Primer design