SecReT4
Protein ID: 148550819
T4SS name [ID]Tra_F [524]
Gene symbol-
Locus tagSwit_5383
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT01 [GenBank: NC_009507] [Browse all T4SS(s) in this replicon]
Location [Strand]289017..291833 [+]
ProductTraG domain-containing protein
Component typeTraG_F
UniProt IDA5VGS5
KEGG IDswi:Swit_5383
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.1e-119, Aligned region: 3..461
Protein Sequence: 938 a.a.     [Download]
>gi|148550819|ref|YP_001260258.1| TraG domain-containing protein [Sphingomonas wittichii RW1]
MLEVFTVGGGEYLVNTFNAVAAWSGGGGYRALLRVVMVMGLIYSLLVVAFTLNYKAWMNWFLQATAIYLC
LMVPTVDIKVTDRVNPSLAPATIDNVPLGLGVLASFTTQIGDWMTRTAETVFVMPGELNYTTNGMVYGAR
LFDATRNFVIRDAEFATNLEKHFKNCVFGDVMLNQKSLTELSKAQDLWAAIGPGSEARSQEWLEKDGSGA
VTSYIVTCRQAYDGLSGQWANMIEANTPIWAKEVYPKLSNALAADKLKHDVPIVNQAFTGSGSSYADYMR
QNTAINAFMQARNSMAGGTGAAAIDTFAQTRADVQARNTYNSIAQQAMAWVPILNIVLTVVFFAMFPVIF
PLFLMPQTGLSALKGYAVGFFYLAAWGPLYVILHMICMTRAETAATGIASGGVTLGTFAGIGAVNGETAT
IAGFMLMSVPFLAAGLARGAMSIAGQSMSMLAPAQNAAEAAALEQTTGNYSYGNVSWANSTSNMQQSDQW
TKAPSYMGGAPMTSWRQDNGALINGFGNGQEVFDTGGAISRLAFTPTMSSGAVAEWREMANEAHRQSQAY
ENAANDILTSTHTNRSAFGTSTERSSGWDSSSGRQANTSIEQFDRRTGSSSQGLEDRSSTSHSERVSDSH
DRSAVTADVVTGRLSAGLGGPQAGGSGTKGGNGGRFGRLPGISGDVSKSGTQQEQLQRSTGQTNSTDSSN
TASSGIRDEHSNGTGASSSDGTYSRSGVFSRASQTSSASVSTEDALSRARSYQESARKLEELSQQLSRDA
SWAESHGMQLSTNLSQDLANWYRAQQAANPGLDAPEIWATDLSEHQRSVRDEMVQRWMSEKREAIYEEIR
GSLNEPDLVDVHRTSVSSAADVRATYHPHGAGGIPAGPSAGDPGAAAAVISSGKAALDGDRAAAQAGRAS
NMQGASRIQSEVNEGHNKGFFLDPELRK
 
Nucleotide Sequence: 2817 bp     [Download]
>gi|148550551|ref|NC_009507.1|:289017-291833 Sphingomonas wittichii RW1 plasmid pSWIT01, complete sequence
ATGCTAGAGGTCTTCACGGTCGGTGGCGGCGAATATCTGGTCAACACCTTCAATGCTGTAGCGGCCTGGT
CAGGGGGCGGGGGCTATCGCGCGCTGCTCCGGGTCGTAATGGTCATGGGCCTCATCTACTCGCTTCTCGT
TGTGGCCTTCACGCTCAACTACAAAGCGTGGATGAACTGGTTCCTCCAGGCCACGGCGATCTATCTGTGC
CTTATGGTGCCGACCGTCGACATCAAGGTGACAGACCGGGTAAATCCGTCGCTCGCGCCGGCAACGATAG
ACAATGTGCCGTTAGGGCTAGGCGTGCTGGCCAGCTTCACCACGCAGATCGGCGACTGGATGACACGCAC
CGCCGAGACCGTGTTCGTGATGCCCGGCGAGCTTAATTACACGACAAATGGCATGGTTTATGGCGCGCGT
CTGTTCGACGCGACGCGCAACTTCGTGATCCGCGACGCCGAGTTTGCGACCAATCTCGAGAAGCATTTCA
AGAACTGTGTGTTCGGCGACGTCATGCTCAACCAGAAATCGCTGACCGAGCTGTCGAAGGCGCAGGATCT
GTGGGCTGCGATCGGCCCGGGTTCGGAAGCGCGCTCCCAGGAATGGTTGGAAAAGGACGGCAGCGGCGCG
GTCACGAGCTATATCGTGACGTGCCGCCAGGCCTATGACGGTCTTTCGGGTCAGTGGGCCAACATGATCG
AGGCCAATACCCCGATCTGGGCGAAAGAGGTCTACCCCAAGCTCAGCAACGCGCTTGCTGCCGACAAGCT
GAAGCATGATGTTCCCATCGTGAACCAGGCGTTCACGGGGTCGGGAAGCAGCTACGCTGACTATATGCGG
CAGAACACCGCGATCAACGCATTCATGCAGGCGCGCAACTCCATGGCGGGTGGCACGGGGGCGGCGGCAA
TCGACACGTTCGCGCAGACCCGTGCCGACGTACAGGCGCGCAACACCTATAATTCGATTGCGCAACAGGC
GATGGCCTGGGTGCCTATCCTCAACATCGTTCTGACAGTCGTATTCTTTGCGATGTTCCCGGTCATCTTC
CCGCTCTTCCTCATGCCGCAAACCGGGCTGAGCGCGCTGAAGGGCTACGCTGTCGGCTTCTTCTACCTGG
CTGCCTGGGGCCCGCTTTACGTGATCCTGCACATGATCTGCATGACGCGCGCCGAGACCGCGGCGACCGG
CATCGCATCGGGCGGCGTTACGCTCGGCACTTTCGCAGGCATCGGCGCCGTGAACGGTGAGACTGCGACG
ATCGCAGGGTTCATGCTGATGTCGGTCCCGTTCCTCGCGGCCGGACTGGCACGCGGCGCGATGTCTATCG
CCGGCCAGTCCATGTCCATGCTCGCGCCCGCACAGAACGCCGCCGAAGCCGCTGCCCTCGAACAGACGAC
GGGCAACTATTCCTATGGGAATGTCAGCTGGGCAAATTCGACGTCCAACATGCAGCAGAGCGACCAGTGG
ACCAAGGCGCCGAGCTATATGGGCGGCGCGCCGATGACAAGTTGGCGCCAGGACAATGGCGCGCTGATCA
ATGGCTTCGGCAACGGGCAGGAGGTCTTCGATACGGGCGGCGCCATTTCACGCCTGGCGTTTACGCCAAC
GATGTCGTCGGGCGCCGTCGCCGAATGGCGCGAAATGGCGAACGAGGCGCACCGTCAGTCGCAGGCCTAT
GAAAACGCCGCAAACGACATTCTGACCTCGACCCATACCAATCGCAGCGCATTCGGAACCTCGACCGAGC
GGTCGTCGGGATGGGATTCGAGCAGCGGCCGCCAGGCCAACACTTCGATCGAACAGTTCGACCGGAGAAC
AGGAAGCAGTTCTCAGGGGCTGGAAGACCGATCCTCGACGAGCCATTCCGAACGGGTTTCAGATAGTCAT
GATCGAAGTGCAGTTACTGCAGACGTCGTAACCGGCAGACTCTCGGCAGGACTGGGAGGTCCGCAAGCGG
GAGGTTCGGGCACGAAGGGCGGCAATGGTGGCAGGTTTGGACGCCTCCCAGGGATCTCAGGAGACGTATC
TAAGTCTGGAACGCAGCAAGAGCAGCTGCAAAGAAGCACAGGACAGACCAATTCCACCGATAGCTCCAAC
ACCGCTTCCAGCGGGATACGCGACGAGCATTCGAACGGCACCGGCGCGAGCTCCTCGGACGGTACCTACA
GTCGGAGTGGCGTGTTCAGTCGCGCCTCGCAGACTTCGTCGGCTTCGGTGAGCACTGAAGACGCTCTCTC
CCGCGCGCGCTCATATCAGGAGTCCGCGCGCAAGCTGGAGGAACTGTCCCAGCAGCTGTCTCGCGACGCC
AGTTGGGCCGAGAGCCATGGCATGCAACTCAGCACGAACCTCAGCCAGGACCTCGCGAACTGGTACCGTG
CGCAACAGGCGGCAAATCCTGGTCTGGATGCTCCCGAAATCTGGGCGACGGACCTTTCCGAGCATCAGCG
CAGTGTCCGGGATGAGATGGTCCAGCGATGGATGTCGGAAAAGCGGGAGGCGATCTACGAGGAAATCCGC
GGAAGCCTGAACGAGCCGGATCTCGTCGATGTGCACCGCACCAGCGTATCGTCCGCAGCCGATGTCAGGG
CGACCTATCATCCGCATGGTGCTGGCGGCATTCCGGCCGGGCCTAGTGCAGGCGATCCCGGCGCAGCAGC
TGCTGTGATTTCGTCAGGCAAAGCTGCGCTAGACGGGGATCGAGCAGCCGCACAAGCGGGTAGAGCTTCC
AATATGCAGGGCGCCTCCCGCATTCAGTCGGAGGTGAATGAGGGCCACAATAAGGGTTTCTTCCTGGATC
CCGAGCTTCGGAAATGA
 Primer design