SecReT4
Protein ID: 148550953
T4SS name [ID]VirB [29]
Gene symbol-
Locus tagSwit_5000
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT02 [GenBank: NC_009508] [Browse all T4SS(s) in this replicon]
Location [Strand]116346..118358 [-]
ProductTRAG family protein
Component typeVirD4
UniProt IDA5VH50
KEGG IDswi:Swit_5000
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.1e-103, Aligned region: 110..542
TraG-D_C [PF12696], Evalue: 3.4e-27, Aligned region: 388..509
TrwB_AAD_bind [PF10412], Evalue: 5.3e-19, Aligned region: 185..520
Protein Sequence: 670 a.a.     [Download]
>gi|148550953|ref|YP_001260383.1| TRAG family protein [Sphingomonas wittichii RW1]
MTRLSDARPLTRVVIVAGVLAATFLACALCAVLVALVGLNQIGPRMQISAIPAWLWYYRGDPLLHLWLKR
GALISGAIAFVILLIILKRGRTLHGEARFARESEIRREHLRSNSGIIVGQKGGRYLVFGGTEHVLLEAPT
RAGKGVGVVIPNLLSWADSVVVLDVKRENWDITAGFRARHGQAVYLFDPLDPEGRSARYNPLSFIDRLDD
TDVINELQKIGGMLFPAPEKADPFWAEAARAAFVGVGALVAANPALPFTIGEIYRRLTAGDPKVELPKVV
EEAQQRGQRLSQACVSALSDFTSASDNTFSGIKQTITSKLNLWLNPYVDAATSETDFDLRQVRRERISIY
LGVSPDNIDRIAPVYNLFLQQLIDLNTRELPENGGRVPVLILLDEFARLGKAPVIASAFSYVAGYGLRLL
PVIQSRSQPRGIYGVDVTDEIIANCGLEIVFTPKELKVASELSERLGYFTMNVKSKSRTIHGLLANRSIS
ESDQRRALMMPQELMQMPKGELLLMRGGIPPVRGRKIEYFRSKRFTSRISDPPKVAPRPIAINAMSSATK
LAGEASSSDPLAQALSAKKAALLSDDQATAPTERAEPVMRALTGNELSGFAEITDDMLVLGDMVDLPPPG
DEQAAIAFVTAMTARAVLEPVGGGAQSPAFVTERHDHDRE
 
Nucleotide Sequence: 2013 bp     [Download]
>gi|148550845|ref|NC_009508.1|:c118358-116346 Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence
TTGACCCGCCTGTCGGACGCACGACCGCTCACTAGGGTCGTAATCGTCGCGGGGGTTCTCGCGGCAACCT
TTTTGGCATGCGCCCTGTGCGCGGTGCTGGTCGCACTGGTCGGCCTGAACCAGATCGGCCCGCGAATGCA
GATCTCGGCGATACCCGCATGGCTCTGGTATTATCGCGGCGATCCGCTGCTTCATCTGTGGCTGAAGCGA
GGCGCGCTGATCAGCGGCGCGATCGCTTTCGTCATCCTGCTCATCATCCTGAAGCGAGGGCGCACGCTCC
ACGGCGAAGCCAGGTTCGCGCGTGAAAGTGAAATCCGCCGCGAACATCTGCGCAGCAACAGCGGGATCAT
CGTCGGACAGAAAGGCGGCCGCTATCTCGTTTTCGGCGGCACCGAACATGTCTTGCTCGAGGCGCCGACG
CGCGCCGGCAAGGGCGTCGGCGTTGTGATCCCCAATCTCCTGAGCTGGGCAGACTCGGTGGTGGTGCTCG
ACGTGAAGCGCGAGAATTGGGACATCACCGCTGGTTTTCGCGCGCGGCATGGCCAGGCGGTCTATCTGTT
CGATCCGCTGGATCCTGAAGGGCGAAGCGCCCGCTACAATCCCTTGAGTTTCATCGACCGGCTCGACGAC
ACCGATGTGATCAATGAACTCCAGAAGATCGGCGGCATGCTGTTTCCGGCCCCGGAAAAGGCTGATCCGT
TCTGGGCGGAAGCGGCGCGCGCCGCCTTTGTCGGCGTCGGCGCCCTTGTCGCAGCCAACCCCGCCCTCCC
CTTCACGATCGGCGAAATCTATCGGCGGCTGACAGCGGGCGATCCGAAGGTCGAACTCCCCAAGGTCGTC
GAGGAGGCGCAGCAGCGCGGGCAGCGGCTGAGCCAGGCGTGTGTGTCGGCGCTGAGCGACTTCACCTCCG
CGTCCGACAACACCTTCTCCGGCATCAAACAGACGATCACCTCGAAGCTCAATCTGTGGCTCAACCCCTA
TGTCGATGCTGCGACATCGGAGACAGATTTTGATCTGCGGCAGGTCCGGCGCGAGCGGATATCGATCTAT
CTTGGGGTGTCGCCCGACAATATCGACCGGATCGCGCCCGTCTATAACCTCTTCCTCCAGCAGCTGATCG
ATCTCAATACGCGGGAACTGCCCGAGAATGGCGGCCGCGTGCCGGTGCTCATTTTGCTCGACGAGTTCGC
CCGCCTCGGCAAGGCGCCGGTCATCGCCTCGGCCTTTTCTTATGTCGCAGGCTACGGGCTTCGCCTGTTG
CCAGTCATACAGAGCCGTTCCCAGCCCCGCGGGATCTATGGCGTGGACGTCACCGACGAGATCATCGCCA
ATTGCGGCCTGGAGATCGTATTTACACCCAAGGAGCTGAAGGTCGCCAGCGAACTCTCCGAGCGGCTTGG
CTATTTCACGATGAACGTCAAATCGAAGAGCCGCACGATTCATGGCCTGCTCGCCAATCGCAGCATCTCG
GAATCAGACCAGCGCCGTGCGCTGATGATGCCGCAGGAACTGATGCAGATGCCCAAGGGCGAGCTTCTGC
TCATGCGCGGAGGCATTCCACCCGTCAGGGGCCGCAAGATCGAGTATTTCCGCTCGAAACGCTTCACGAG
CCGGATCAGTGACCCACCCAAGGTCGCGCCCCGTCCGATCGCGATCAACGCCATGTCGTCGGCCACCAAA
TTGGCAGGCGAGGCGAGCAGCAGTGATCCTTTGGCGCAGGCCCTTAGCGCGAAGAAGGCCGCCTTGTTGA
GCGACGATCAGGCGACCGCGCCGACAGAACGGGCGGAACCTGTCATGCGCGCGCTCACCGGTAACGAACT
CTCGGGCTTTGCCGAAATCACCGATGACATGTTGGTGCTGGGCGACATGGTGGATCTACCACCGCCCGGT
GACGAACAGGCAGCTATCGCCTTTGTCACGGCGATGACGGCCCGGGCCGTTCTCGAGCCCGTGGGTGGAG
GCGCCCAATCTCCAGCATTTGTGACCGAAAGGCATGACCATGACAGAGAATGA
 Primer design