SecReT4
Protein ID: 148550954
T4SS name [ID]VirB [29]
Gene symbol-
Locus tagSwit_5001
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT02 [GenBank: NC_009508] [Browse all T4SS(s) in this replicon]
Location [Strand]118324..119328 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDA5VH51
KEGG IDswi:Swit_5001
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-72, Aligned region: 13..312
DEAD [PF00270], Evalue: 7.5e-06, Aligned region: 159..213
Mg_chelatase [PF01078], Evalue: 2e-05, Aligned region: 154..202
AAA_29 [PF13555], Evalue: 2.1e-05, Aligned region: 144..188
FtsK_SpoIIIE [PF01580], Evalue: 4.2e-05, Aligned region: 154..182
Protein Sequence: 334 a.a.     [Download]
>gi|148550954|ref|YP_001260384.1| P-type DNA transfer ATPase VirB11 [Sphingomonas wittichii RW1]
MSDTAVLRHYLAPILPLLEPVEVTELVINKPGEVGIEDHRGWHWHNVAELDSDWLATLAVAAASFTRQDV
NAETPICSTILPGGERCQIVIPSVTPTGAPSFTVRKPSRVNLAIDQLAQTGLFAGTRSASHGLGEVDAQL
VAQRDAADWPAFFKTAVAARKNILVSGATGSGKTTFAKALIQLIPPEERLLTIEDTRELVVEHRNVVHMV
YSSERQGLAKVGPKQLLESALRMRPDRILLQELRDGTAFFYLRNVNSGHPGSITTVHAGSALGAFEQLTL
LVKESEGGRDLARDDIRGLLHMLVDVVVQTRKRAGKFEVEEVYFDPPVGRTTAH
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|148550845|ref|NC_009508.1|:c119328-118324 Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence
ATGAGCGATACCGCCGTCCTGCGCCATTATCTCGCGCCGATCCTGCCGCTGCTGGAGCCGGTCGAGGTGA
CGGAGCTTGTCATCAACAAGCCCGGCGAAGTCGGCATCGAAGATCATCGCGGTTGGCATTGGCATAACGT
CGCCGAACTCGACAGCGACTGGCTCGCGACGCTGGCCGTCGCCGCCGCGAGCTTCACCCGGCAGGACGTC
AATGCCGAGACCCCGATCTGCTCGACCATTTTGCCAGGCGGCGAGCGCTGCCAGATCGTCATACCCTCGG
TAACCCCGACCGGCGCGCCATCCTTCACGGTGCGCAAGCCTTCGCGCGTCAATCTCGCGATCGATCAACT
CGCGCAAACAGGTTTGTTCGCTGGCACACGCTCGGCCTCCCACGGTCTCGGCGAGGTCGATGCCCAGCTG
GTGGCGCAGCGCGATGCCGCTGACTGGCCGGCGTTCTTCAAGACCGCCGTTGCCGCCCGTAAGAACATCC
TGGTGAGCGGCGCGACCGGCTCGGGCAAGACCACCTTCGCCAAGGCGCTGATCCAACTGATCCCGCCCGA
GGAACGGCTGCTGACGATCGAGGATACGCGCGAGCTCGTCGTCGAGCATCGCAACGTCGTGCACATGGTC
TATTCGAGCGAGCGACAGGGGCTGGCGAAGGTCGGCCCCAAGCAGCTGCTCGAAAGTGCGCTGCGCATGC
GGCCCGATCGCATCCTCCTGCAGGAGCTGCGCGACGGCACCGCCTTCTTTTATCTGCGCAACGTCAACTC
GGGGCACCCGGGTTCGATCACAACCGTCCATGCCGGCTCGGCGTTGGGCGCGTTCGAGCAGCTGACGTTG
CTGGTCAAGGAATCCGAAGGCGGGCGCGATCTGGCCCGCGACGACATCCGCGGGCTGTTGCACATGCTCG
TCGACGTGGTCGTCCAGACGCGCAAGCGCGCCGGAAAATTCGAAGTCGAGGAGGTGTATTTTGACCCGCC
TGTCGGACGCACGACCGCTCACTAG
 Primer design