SecReT4
Protein ID: 148550957
T4SS name [ID]VirB [29]
Gene symbol-
Locus tagSwit_5004
StrainSphingomonas wittichii RW1
Repliconplasmid pSWIT02 [GenBank: NC_009508] [Browse all T4SS(s) in this replicon]
Location [Strand]121409..122098 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA5VH54
KEGG IDswi:Swit_5004
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.8e-61, Aligned region: 19..226
Protein Sequence: 229 a.a.     [Download]
>gi|148550957|ref|YP_001260387.1| VirB8 family protein [Sphingomonas wittichii RW1]
MRNQTEGVPAKDAELYFGHARSWDQDRQRKSLRSERIAWVVAGLGLLAATAEGFALAGLAPLKTVMPYII
RVNQTTGAVDVQTTLTQKPMRYDEAVTKFFLAQYVRARESWLPAAAEENFRAVTILSEPGEQQRWGRFFN
SNNAASPQVVWGKGAVVQARVRNIAFINDRVANVRFTRTVQTDTDTQSSDWIATVTFRYTNAPMAEGDRY
RNPLGFQVENYRADPEVVR
 
Nucleotide Sequence: 690 bp     [Download]
>gi|148550845|ref|NC_009508.1|:c122098-121409 Sphingomonas wittichii RW1 plasmid pSWIT02, complete sequence
ATGCGGAACCAGACCGAAGGCGTGCCGGCAAAAGACGCTGAACTCTATTTCGGGCATGCCCGATCGTGGG
ATCAGGACCGTCAGCGCAAATCGTTACGATCCGAACGCATCGCCTGGGTCGTGGCCGGCCTGGGGCTGCT
TGCCGCGACCGCGGAGGGCTTCGCACTCGCGGGCCTGGCCCCGCTGAAAACGGTCATGCCGTACATCATT
CGCGTCAATCAGACCACAGGCGCGGTCGATGTGCAGACCACCCTCACCCAGAAGCCGATGCGCTATGACG
AGGCGGTCACGAAATTCTTCCTCGCACAATATGTCAGGGCGAGAGAGAGCTGGTTGCCGGCGGCGGCCGA
GGAGAATTTTCGCGCTGTCACAATCCTGTCCGAACCAGGCGAGCAGCAGCGCTGGGGCCGGTTTTTCAAC
TCGAACAACGCCGCGAGCCCACAGGTCGTCTGGGGCAAGGGTGCGGTCGTCCAGGCCCGCGTGCGCAATA
TCGCCTTCATCAACGATCGTGTGGCCAATGTCCGTTTCACGCGGACAGTGCAGACCGACACCGATACGCA
GAGCAGCGACTGGATCGCAACGGTCACCTTCCGGTACACGAATGCGCCGATGGCGGAGGGCGATCGCTAT
CGCAACCCATTGGGGTTCCAGGTCGAGAATTACCGCGCGGACCCAGAGGTGGTGCGGTGA
 Primer design