SecReT4
Protein ID: 148553088
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0161
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]154172..155143 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDA5V2L6
KEGG IDswi:Swit_0161
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.6e-84, Aligned region: 23..287
Protein Sequence: 323 a.a.     [Download]
>gi|148553088|ref|YP_001260670.1| P-type conjugative transfer ATPase TrbB [Sphingomonas wittichii RW1]
MTQPSAIVHARSTSMLRSALGPAIAAWLDDNGVAEVMLNADGRLWVDRLDSGMAETGERLTAAQAERIIR
LVAHHVGAEVHRATPRVSAELPESGERFEGLLPPVVAAPVFSIRRPASLPLALADYVAAGTMTATAAAFL
AGAVKDRANILVAGGTSTGKTTLTNALLAVASDSDDRIILIEDTRELRCDAANVLALRTAPGVTMTDLVR
SSLRLRPDRIPVGEVRGPEALDLLKAWGTGHPGGIGTIHAGTATSALHRLEQLILEAIAHVPRPLIAETI
DVIAVLSGRGTERRLSELVRVEGLDAAGAYCLRNIHTAQGVTA
 
Nucleotide Sequence: 972 bp     [Download]
>gi|148552929|ref|NC_009511.1|:154172-155143 Sphingomonas wittichii RW1 chromosome, complete genome
GTGACCCAGCCCTCTGCCATCGTCCATGCGCGCAGCACTTCGATGCTGCGCAGCGCGCTCGGGCCGGCGA
TCGCCGCCTGGCTCGACGACAATGGCGTCGCCGAGGTCATGCTCAACGCCGACGGCCGGTTGTGGGTCGA
CCGGCTCGACAGCGGCATGGCCGAGACCGGCGAGCGCCTGACCGCGGCACAGGCCGAGCGCATCATCCGC
CTTGTCGCCCATCACGTCGGGGCGGAGGTCCACCGCGCAACGCCCCGCGTGTCAGCCGAGCTGCCCGAGA
GCGGCGAGCGCTTCGAAGGCCTGCTGCCGCCTGTGGTCGCGGCACCCGTCTTCTCGATCCGGCGGCCGGC
GAGTTTGCCGCTGGCGCTCGCCGACTATGTCGCCGCCGGTACCATGACCGCGACGGCCGCCGCCTTCCTG
GCCGGGGCAGTCAAGGATCGCGCCAATATTCTCGTCGCGGGCGGCACATCGACCGGCAAGACGACGCTCA
CCAATGCGCTGCTCGCGGTCGCGTCCGACAGCGACGACCGCATCATCCTGATAGAGGATACCCGCGAGCT
GCGCTGCGACGCGGCTAATGTCCTGGCGCTGCGCACTGCGCCGGGGGTCACGATGACCGACCTGGTACGC
TCCAGCCTGCGCCTGCGGCCCGATCGCATTCCGGTCGGCGAAGTGCGAGGCCCGGAAGCGCTCGACCTGC
TCAAAGCCTGGGGCACCGGCCATCCCGGCGGGATCGGTACGATTCACGCCGGCACCGCGACCTCCGCGCT
CCACCGGCTCGAACAGCTCATCCTCGAAGCCATCGCGCACGTCCCGCGCCCCCTGATCGCCGAGACGATC
GACGTCATCGCGGTGCTCAGCGGTCGCGGCACCGAGCGCCGCCTGTCCGAGCTGGTCCGTGTCGAAGGGC
TCGATGCGGCCGGCGCCTACTGCCTCCGCAACATCCATACAGCACAGGGAGTCACCGCATGA
 Primer design