SecReT4
Protein ID: 148553089
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0162
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]155140..155454 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA5V2L7
KEGG IDswi:Swit_0162
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-24, Aligned region: 4..94
Protein Sequence: 104 a.a.     [Download]
>gi|148553089|ref|YP_001260671.1| conjugal transfer protein TrbC [Sphingomonas wittichii RW1]
MIRVRSARLAAALALAALYAAPAWAGGSGMPWETPLQSIVDSVQGPVARVIGVIIIVITGLTLAFGDTAG
GFRRLIQIVFGLSVAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 315 bp     [Download]
>gi|148552929|ref|NC_009511.1|:155140-155454 Sphingomonas wittichii RW1 chromosome, complete genome
ATGATCCGTGTCCGTTCCGCCCGTCTTGCCGCCGCGCTGGCGCTGGCGGCGCTCTACGCCGCGCCCGCCT
GGGCAGGCGGCTCGGGCATGCCGTGGGAGACTCCGCTCCAGTCGATCGTGGATTCAGTGCAGGGTCCGGT
CGCGCGCGTGATCGGCGTCATCATCATCGTCATCACCGGCCTGACCCTCGCCTTCGGCGACACGGCTGGC
GGGTTCCGTCGGCTGATCCAGATCGTGTTCGGCCTGTCGGTCGCGTTCGCGGCCAGCTCCTTCTTCCTCT
CCTTCTTCAGCTTTGGCGGCGGGGCGCTCGTCTGA
 Primer design