SecReT4
Protein ID: 148553090
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0163
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]155454..155720 [+]
ProductType IV secretory pathway TrbD component-like protein
Component typeTrbD
UniProt IDA5V2L8
KEGG IDswi:Swit_0163
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.9e-09, Aligned region: 11..78
Protein Sequence: 88 a.a.     [Download]
>gi|148553090|ref|YP_001260672.1| Type IV secretory pathway TrbD component-like protein [Sphingomonas wittichii RW1]
MGEEDLPGFAVPVHRALAEPIMLAGAPRALAIFNGTLAAAVGIGLRLWIAGIVIAIVGHGLAVFAARRDP
QILPVARRHMALPTLFES
 
Nucleotide Sequence: 267 bp     [Download]
>gi|148552929|ref|NC_009511.1|:155454-155720 Sphingomonas wittichii RW1 chromosome, complete genome
ATGGGCGAGGAGGATCTCCCCGGCTTCGCGGTGCCGGTTCACCGGGCGCTCGCCGAGCCGATCATGCTGG
CCGGCGCGCCAAGGGCACTTGCCATCTTCAACGGCACGCTCGCCGCCGCAGTCGGGATCGGCCTCAGGCT
CTGGATCGCCGGCATCGTCATCGCGATCGTGGGGCACGGCCTCGCCGTCTTCGCCGCGCGCCGCGATCCG
CAGATCCTCCCGGTTGCCCGTCGCCACATGGCGCTTCCCACCCTCTTCGAAAGCTGA
 Primer design