SecReT4
Protein ID: 148553091
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0164
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]155727..158195 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA5V2L9
KEGG IDswi:Swit_0164
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 6.7e-32, Aligned region: 446..726
CagE_TrbE_VirB [PF03135], Evalue: 1.8e-12, Aligned region: 186..290
CagE_TrbE_VirB [PF03135], Evalue: 1.8e-12, Aligned region: 299..392
Protein Sequence: 822 a.a.     [Download]
>gi|148553091|ref|YP_001260673.1| conjugal transfer ATPase TrbE [Sphingomonas wittichii RW1]
MMFLREHARRASRLSDFLPWAAMIAPGIVLNKDGSFLRVARFRGPDLDSATQAELIATSNRLNSALKRLG
TGWAIYVEAQRKASPGYPVSTGFADPVSALIDEERRDQFEGGDVTQPNFTSAYYLTLQWLPPADDTSRAS
SMLFEGGAEGIATAADHLEDFERDTGRVLDMIEGVMPEAAWLSDGETLTFLHSTISTHEQNIAVPETPMH
LDALLADDALVGGLTPQLGEKHLRVLSITGFPAWTVPGMLDELNRLGFAYRWTTRAICMDKVTAQRTLSR
IRRLWFSKRKSLAAIVKEVLTNEASVLVDTDATNKSADADAALQELGADIAGFAYVTTTITVLGDTPRDA
DLKLQSIEKIVRGRDFACIAESLNALEAWLGSLPGNPYANVRQPPISTLNLAHVMPVSAVWAGQDEDTHL
GAPPLFHARTEGATPFRFSLHVGDVGHTLVVGPTGSGKSVLLAFMALQFRRYEGAQIFAFDHGGSIRAAT
LGVGGEWHDLGGALGGGGAPVALQPLARIDELDERAWAADWLAAILAQEVFAITPEVKDHLWTALGSLAD
APLEQRTLTGLAVLIQASGLKRALQPYTLAGPYGRLLDADGERFGTHDAQAFETEGLVGTPAAPAVLAYL
FHRIGRRLDGRPTLILIDEGWLALDDPLFGRQLKEWLKTLRKKNASVVFATQSLADIEGSAIAPAIIESC
PTRLFLANERALEPQIAGIYRRFGLNDRQIEIIASATPKRDYYCQSALGNRLFDLGLGPLALAFAAASQR
SDLNAISALLDAHGADGFADAWLRHRGLGWAADIVTAERPPSPALQEEEIIA
 
Nucleotide Sequence: 2469 bp     [Download]
>gi|148552929|ref|NC_009511.1|:155727-158195 Sphingomonas wittichii RW1 chromosome, complete genome
ATGATGTTCCTCCGCGAGCATGCCCGCCGCGCATCGCGCCTCTCGGATTTCCTGCCATGGGCGGCGATGA
TCGCGCCCGGCATCGTCCTCAACAAGGACGGGAGCTTCCTGCGCGTGGCGCGGTTCCGTGGCCCCGATCT
CGACAGCGCGACCCAGGCTGAGCTCATCGCCACCTCCAATCGGCTCAACAGCGCCTTGAAACGCCTCGGC
ACCGGCTGGGCGATCTATGTCGAGGCGCAGCGCAAGGCCTCGCCCGGCTATCCGGTCTCGACCGGGTTCG
CCGATCCGGTGTCCGCGCTGATCGACGAGGAGCGGCGCGACCAGTTCGAGGGCGGCGACGTCACCCAGCC
CAATTTCACCAGCGCCTACTATCTCACCCTGCAATGGCTCCCCCCGGCCGACGACACGTCGCGCGCCTCC
TCAATGCTGTTCGAGGGCGGCGCGGAAGGGATCGCGACCGCCGCCGATCATCTGGAGGATTTCGAGCGGG
ACACGGGCCGCGTCCTCGACATGATCGAGGGCGTGATGCCGGAAGCCGCCTGGCTCTCCGACGGCGAGAC
GCTGACCTTTCTGCATTCGACGATCTCGACGCACGAGCAGAACATCGCCGTGCCGGAGACGCCGATGCAC
CTCGATGCGCTGCTCGCCGACGACGCCCTAGTCGGCGGCCTGACGCCACAACTCGGCGAGAAGCATCTGC
GGGTTCTCTCCATTACCGGCTTTCCGGCCTGGACGGTGCCGGGCATGCTGGACGAGCTCAATCGGCTAGG
CTTCGCCTATCGCTGGACCACCCGTGCGATCTGCATGGACAAGGTGACGGCACAGCGCACCCTGAGCAGG
ATCCGCCGCCTCTGGTTCTCCAAGCGCAAGAGCCTCGCCGCGATCGTCAAGGAGGTGCTGACCAACGAGG
CCAGCGTCCTCGTCGATACGGACGCGACCAACAAGTCGGCCGACGCCGATGCCGCCCTGCAGGAACTCGG
CGCCGACATCGCCGGGTTCGCCTATGTCACCACCACCATCACGGTGCTGGGCGACACGCCGCGCGATGCC
GACCTCAAGCTCCAGTCGATCGAGAAGATCGTGCGCGGGCGGGATTTCGCGTGCATCGCCGAGAGCCTCA
ACGCGCTCGAAGCCTGGCTCGGCTCGCTCCCCGGCAACCCTTACGCCAACGTCCGCCAGCCGCCGATCTC
GACCCTCAATCTCGCCCATGTGATGCCGGTCTCGGCGGTCTGGGCCGGGCAGGACGAAGATACGCATCTG
GGCGCCCCGCCGCTGTTCCATGCGCGCACTGAAGGCGCGACCCCGTTCCGCTTCTCGCTCCATGTCGGCG
ATGTTGGGCACACGCTGGTCGTCGGCCCGACCGGCTCGGGCAAGAGCGTGCTGCTCGCCTTCATGGCGCT
CCAGTTCCGCCGCTACGAGGGCGCGCAGATCTTCGCCTTCGACCATGGCGGCTCGATCCGCGCCGCGACT
CTCGGCGTGGGCGGCGAGTGGCACGACCTCGGCGGCGCGCTCGGCGGCGGCGGCGCGCCGGTCGCACTCC
AGCCGCTCGCGCGCATCGACGAGCTCGACGAGCGCGCCTGGGCCGCCGACTGGCTCGCCGCGATCCTGGC
CCAGGAAGTGTTCGCGATCACCCCGGAGGTGAAGGACCATCTCTGGACCGCGCTGGGGAGCCTCGCCGAC
GCGCCGCTCGAGCAGCGCACCCTGACCGGCCTTGCCGTGCTGATCCAGGCCTCGGGCCTCAAACGCGCGC
TTCAACCCTATACGCTGGCTGGCCCCTATGGGCGGCTGCTCGACGCCGACGGCGAGCGGTTCGGGACGCA
TGACGCCCAGGCATTCGAGACCGAAGGGCTGGTCGGCACGCCGGCCGCGCCGGCGGTGCTCGCTTATCTG
TTCCACCGAATCGGGCGCCGGCTCGACGGGCGGCCGACGCTGATCCTGATCGACGAGGGCTGGCTCGCGC
TCGACGATCCCCTGTTCGGCCGCCAGCTCAAGGAATGGCTGAAGACGCTGCGCAAGAAGAACGCGTCGGT
CGTCTTCGCCACCCAGAGCCTCGCCGATATCGAAGGCTCGGCCATCGCCCCGGCGATTATCGAGAGCTGC
CCGACCCGGCTGTTCCTCGCCAATGAGCGCGCACTCGAGCCGCAGATCGCCGGCATCTACCGGCGGTTCG
GGCTCAACGATCGCCAGATCGAGATCATCGCCTCGGCGACGCCCAAGCGCGATTATTACTGCCAGTCGGC
GCTGGGCAACCGATTGTTCGATCTCGGTCTCGGCCCGCTCGCGCTCGCCTTCGCCGCCGCCTCGCAGCGC
AGCGACCTCAATGCGATTTCCGCGCTGCTCGACGCCCATGGCGCTGACGGTTTCGCCGATGCCTGGCTTC
GCCATCGCGGCCTCGGCTGGGCCGCCGACATCGTCACGGCCGAGCGCCCTCCATCCCCCGCCCTCCAAGA
AGAGGAGATCATCGCATGA
 Primer design