SecReT4
Protein ID: 148553092
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0165
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]158192..158926 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA5V2M0
KEGG IDswi:Swit_0165
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 244 a.a.     [Download]
>gi|148553092|ref|YP_001260674.1| conjugal transfer protein TrbJ [Sphingomonas wittichii RW1]
MTPIRTFFVGAAALALLAAPPASAQITVYDPTNYSQNLLSAARALQQINNQITSLQNEAAMLLNQARNLT
SLPTSTLSQIQQSMDRTRQLIGEARQIAYNVQDIDRVFDQRYPAGSLAGTSHGQMVGNAEDRWRDAVASF
QDALRTQATIVTNLTDTRRELDTLVGASQDATGALQAAQAGNQLVALQTRQIADLTALVAAQGRAAAIEA
ARAAADEAQARERGRRFIGTRSEYRPRSVTIFND
 
Nucleotide Sequence: 735 bp     [Download]
>gi|148552929|ref|NC_009511.1|:158192-158926 Sphingomonas wittichii RW1 chromosome, complete genome
ATGACCCCTATCCGCACCTTCTTTGTCGGCGCCGCCGCGCTGGCGCTGCTCGCCGCGCCGCCCGCGTCCG
CGCAGATCACGGTCTATGACCCGACCAACTACTCGCAGAACCTGCTCTCGGCGGCCCGCGCGCTCCAGCA
GATCAACAACCAGATCACCTCGCTGCAGAACGAGGCGGCGATGCTCCTCAATCAGGCGCGCAACCTGACC
TCGCTCCCGACCAGCACCTTGTCGCAGATCCAGCAGTCGATGGACCGCACGCGCCAGCTGATCGGCGAGG
CGCGACAGATCGCCTACAATGTCCAGGACATCGACCGCGTGTTCGACCAGCGTTATCCGGCGGGATCGCT
CGCCGGAACCAGCCACGGCCAGATGGTCGGGAACGCGGAAGACCGCTGGCGCGATGCGGTGGCGAGCTTC
CAGGATGCGCTGCGCACGCAAGCGACGATCGTCACCAACCTCACCGACACCCGCCGCGAGCTCGACACTC
TGGTCGGGGCCAGCCAGGACGCGACCGGCGCGCTGCAGGCGGCGCAGGCGGGGAACCAGCTCGTCGCGCT
CCAGACCAGGCAGATTGCGGACCTGACCGCGCTGGTCGCCGCGCAGGGCCGCGCCGCCGCGATCGAGGCG
GCGCGCGCCGCAGCGGACGAGGCGCAGGCGCGCGAGCGCGGTCGCCGGTTCATCGGTACGCGCAGCGAAT
ATCGTCCGCGCAGCGTGACAATCTTCAATGACTGA
 Primer design