SecReT4
Protein ID: 148553094
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0167
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]159290..160606 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5V2M2
KEGG IDswi:Swit_0167
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.8e-49, Aligned region: 37..261
Protein Sequence: 438 a.a.     [Download]
>gi|148553094|ref|YP_001260676.1| conjugal transfer protein TrbL [Sphingomonas wittichii RW1]
MQNTGVIDRFLDLFGRYIDSGFGLIGGDVGFLASALIVIDVTLAFLFWTWGGDEDIIARLVKKTLQVGFF
AFLISNWNALAQVIYLSFSGIGLKAAGSGSPDDLLHPGRIAQVGIDAGRPLIEQASELAGPVGLFTNFAE
IAVLLIAWAIVLLAFLIIAIQIFVTLIEFKLVTLAGFVLVPFGLFGRTAFLAERVLGNVMATGVKVLVLA
IIIGIGSTIFDEFVRDFGGTPPDLEQVASLALAALTLLGLAIFGPGIAAGLVSGGPQLGAGAAVATGIVA
TGAGAAVGMGAASLAGAGARAGTRAAGSLSSRSAARASGGSPSAPSPPPAPAGGAPAVPPPSGAPKGGGA
SATRSPAPASSGAPASAVETESPTAASSPDPVVTGGPALPPAAPHAPAWANRLRRRQAMMQGATMAAYAL
RSSDSGGGAAQISVEDRS
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|148552929|ref|NC_009511.1|:159290-160606 Sphingomonas wittichii RW1 chromosome, complete genome
ATGCAGAATACGGGCGTCATCGATCGCTTCCTCGACCTGTTCGGCCGCTACATCGATTCGGGCTTCGGCC
TGATTGGCGGCGACGTCGGGTTCCTCGCCAGCGCGCTCATCGTCATCGACGTGACGCTCGCCTTCCTGTT
CTGGACCTGGGGCGGCGACGAGGACATCATCGCCCGGCTGGTCAAGAAGACCCTGCAGGTCGGGTTCTTC
GCGTTCCTGATCTCCAACTGGAACGCGCTGGCGCAGGTCATCTATCTGAGCTTTTCGGGCATCGGCCTCA
AGGCCGCCGGATCGGGAAGCCCTGACGATCTGCTCCATCCCGGCCGGATCGCGCAGGTCGGCATCGACGC
CGGGCGGCCGCTCATCGAGCAGGCTTCCGAGCTCGCCGGCCCGGTCGGCCTGTTCACCAATTTCGCGGAG
ATCGCGGTGCTGCTGATCGCCTGGGCGATCGTGCTGCTCGCCTTCCTGATCATCGCGATCCAGATCTTCG
TCACCCTGATCGAGTTCAAGCTCGTGACCCTGGCCGGGTTCGTGCTGGTGCCCTTCGGCCTGTTCGGCCG
CACCGCCTTCCTCGCCGAGCGGGTGCTCGGCAATGTCATGGCGACTGGCGTCAAGGTGCTGGTCCTCGCC
ATCATCATCGGCATCGGCTCGACCATCTTCGACGAGTTCGTGCGCGATTTCGGGGGCACGCCGCCCGATC
TCGAGCAGGTCGCGAGCCTGGCGCTCGCGGCGCTCACCCTGCTCGGCCTCGCCATCTTCGGCCCCGGCAT
CGCCGCCGGCCTGGTCTCGGGCGGCCCGCAATTGGGTGCCGGCGCCGCGGTCGCCACCGGCATCGTCGCC
ACCGGCGCGGGCGCGGCGGTCGGCATGGGCGCCGCCAGCCTGGCCGGAGCCGGGGCACGCGCCGGCACGC
GCGCCGCCGGTTCGCTCTCCTCCCGGTCCGCCGCCCGCGCGAGCGGTGGATCCCCGTCGGCGCCATCGCC
CCCTCCGGCGCCGGCGGGCGGCGCGCCCGCGGTTCCCCCGCCGTCGGGCGCGCCGAAGGGGGGCGGCGCT
TCGGCTACTCGATCGCCCGCGCCAGCATCGTCCGGTGCCCCGGCATCGGCCGTAGAGACTGAAAGCCCGA
CAGCCGCATCGTCACCCGATCCTGTCGTCACCGGTGGACCGGCATTGCCCCCCGCCGCGCCGCATGCGCC
GGCCTGGGCGAACCGGCTGCGCCGCCGCCAGGCGATGATGCAAGGCGCAACCATGGCCGCCTATGCACTG
CGCTCGTCGGACTCCGGCGGCGGCGCGGCGCAGATTTCCGTGGAGGACCGTTCATGA
 Primer design