SecReT4
Protein ID: 148553095
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0168
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]160603..161292 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA5V2M3
KEGG IDswi:Swit_0168
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.4e-49, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|148553095|ref|YP_001260677.1| conjugal transfer protein TrbF [Sphingomonas wittichii RW1]
MNPFRRPSSRFGREPKPETPYQRAQQAWDDRIGSARAQAYSWRLMAFGAIAVLGLSAADNLRLRYGTKVV
PYVVEVDRLGAARAVAPLEAGYRPTDPQIAWHLARFIENVRARPADPIVLRQNLSAAYDFTTEQGAASLN
DYARANDPFASLADTQVGVDIRNVVRASADSFRIAWDERRYVRGQLATTTRWSAVLTIVVRTPTDAPTLS
RNPLGLYVHALNWSQDLGD
 
Nucleotide Sequence: 690 bp     [Download]
>gi|148552929|ref|NC_009511.1|:160603-161292 Sphingomonas wittichii RW1 chromosome, complete genome
ATGAATCCCTTTCGCCGCCCCTCGTCGCGGTTCGGCCGCGAGCCGAAACCCGAGACGCCCTATCAACGTG
CCCAGCAGGCCTGGGACGATCGCATCGGCTCCGCGCGGGCGCAGGCCTACAGCTGGCGGCTGATGGCGTT
CGGCGCGATTGCGGTGCTCGGCCTGTCGGCCGCCGACAATCTGCGCCTGCGCTACGGCACGAAGGTTGTG
CCCTATGTGGTCGAGGTCGATCGCCTCGGAGCGGCGCGCGCCGTCGCTCCTTTGGAGGCCGGCTATCGGC
CGACCGATCCGCAGATCGCGTGGCACCTCGCCCGCTTCATCGAGAATGTCCGCGCCCGGCCCGCCGATCC
GATCGTGCTGCGGCAGAATCTGAGCGCCGCCTATGATTTCACGACCGAGCAGGGCGCGGCGTCGCTCAAT
GACTATGCCCGCGCCAACGACCCGTTCGCCAGTCTCGCCGACACCCAGGTCGGGGTCGACATCCGCAATG
TCGTGCGCGCCTCGGCCGACAGCTTCCGCATCGCCTGGGACGAGCGCCGCTATGTGCGGGGCCAGCTGGC
CACGACGACGCGCTGGTCGGCGGTGCTTACCATCGTCGTGCGCACCCCGACCGACGCCCCGACGCTGAGC
CGCAACCCGCTCGGCCTCTACGTCCACGCCCTCAACTGGTCCCAGGATCTCGGAGACTGA
 Primer design