SecReT4
Protein ID: 148553096
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0169
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]161296..162132 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA5V2M4
KEGG IDswi:Swit_0169
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.6e-66, Aligned region: 48..270
Protein Sequence: 278 a.a.     [Download]
>gi|148553096|ref|YP_001260678.1| P-type conjugative transfer protein TrbG [Sphingomonas wittichii RW1]
MRTLLLATTMLLPAAAAAQAPERGTRPVAAATDAARIAPREAGWQGATQLFAYAPGGLYQVYAAVGRVTD
IVLQEGESLSDTGAVAAGDTVRWVIGEAASGTGPTRRVHILVKPTDPGLITNLVINTDRRTYHVELRSTP
STYMASVGWSYPQDELIAIEARQRAAEQVAATRVQAGIEAASLDFAYRLRGANPPWRPTQVFDDGAKTYI
LFPETIAQSELPPLFLIGERNQAELVNYRFSGRYMIVDRLFERAEFRLGTRRQEIVRIERTRARERQQ
 
Nucleotide Sequence: 837 bp     [Download]
>gi|148552929|ref|NC_009511.1|:161296-162132 Sphingomonas wittichii RW1 chromosome, complete genome
ATGCGAACTTTGCTTCTCGCTACCACCATGCTGTTGCCCGCCGCCGCGGCCGCCCAGGCGCCCGAGCGCG
GCACGCGCCCGGTCGCCGCCGCCACCGACGCCGCCCGCATCGCTCCTCGTGAGGCGGGCTGGCAGGGCGC
GACCCAGCTGTTCGCTTACGCGCCCGGCGGGCTCTATCAGGTCTATGCGGCGGTCGGCCGCGTCACCGAC
ATCGTGCTGCAGGAAGGCGAGAGCCTGTCCGACACCGGCGCGGTCGCGGCCGGCGACACGGTGCGCTGGG
TGATCGGCGAGGCCGCGAGCGGTACCGGCCCCACTCGTCGCGTGCACATATTGGTGAAGCCGACCGATCC
GGGCCTGATCACCAATCTCGTCATCAACACCGACCGGCGCACCTATCATGTCGAGCTCAGATCGACGCCG
TCGACCTACATGGCGAGCGTGGGCTGGTCCTACCCGCAGGACGAGCTGATTGCGATCGAGGCGCGGCAGC
GCGCCGCCGAACAGGTAGCGGCGACCCGGGTCCAGGCCGGAATCGAGGCTGCCAGCCTCGACTTCGCTTA
TCGGCTGCGCGGCGCCAATCCGCCGTGGCGTCCCACGCAGGTGTTCGACGACGGCGCCAAGACCTACATC
CTGTTCCCGGAGACGATTGCGCAAAGCGAGCTGCCGCCCTTGTTCCTGATCGGCGAGCGCAACCAAGCCG
AGCTCGTCAACTATCGCTTCTCGGGCCGCTACATGATCGTCGACCGCCTGTTCGAGCGCGCCGAGTTCCG
CCTCGGCACGCGGCGGCAGGAGATCGTTCGCATCGAGCGCACGCGCGCCCGGGAGCGGCAGCAGTGA
 Primer design