SecReT4
Protein ID: 148553097
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0170
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]162132..163319 [+]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDA5V2M5
KEGG IDswi:Swit_0170
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-56, Aligned region: 207..385
Protein Sequence: 395 a.a.     [Download]
>gi|148553097|ref|YP_001260679.1| conjugation TrbI family protein [Sphingomonas wittichii RW1]
MDHRHDPSDPAQPRAPLSTRATPPRPRRLSRKAIALLSGAGAFAVAGALAYSLSGTSGQRGPQETVSVER
RQAELLSDAPRDYSELAERSAEGMGPPAPMTPDPEPTFGGTESGAAPSTTEADQAEQRRRQQAESARGSR
LFAGAGEGRGPPQAANATPTEPAPAPPAEGTSRAGAPLDRRAAFVAGGTPEPTTNSGRLTPPPGRHVVTA
GSTIAAALITGLSSDLAGQVVAQVTEDVFDSVTGRTKLIPQGTRLLGVYDSNVSTGQSRALVVWTRMILP
DGRSIGLDRLVGTDAAGQSGFADRVNNHWGTILRAGLLSTLLGVGTQASGFGQNDAIADAIRDSAGQTVG
RAGDRIVERQLGIQPTISVRPGARVRVLVSRDLILEPWPGRDAGG
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|148552929|ref|NC_009511.1|:162132-163319 Sphingomonas wittichii RW1 chromosome, complete genome
ATGGACCACCGGCACGATCCAAGCGATCCGGCGCAGCCGCGCGCGCCGCTTTCGACCCGCGCCACGCCGC
CCCGGCCGCGCCGCTTGTCGCGCAAGGCAATCGCGTTGCTGTCCGGTGCGGGAGCATTCGCGGTGGCGGG
TGCGCTCGCCTACAGCCTGTCGGGCACGTCAGGCCAACGCGGGCCACAAGAGACGGTGTCGGTCGAGCGC
CGCCAGGCGGAGCTGCTGAGCGATGCGCCGCGTGACTATAGCGAGTTGGCGGAACGATCGGCGGAAGGAA
TGGGACCGCCCGCGCCGATGACGCCGGACCCCGAGCCGACATTCGGCGGCACCGAAAGCGGCGCGGCGCC
ATCCACCACCGAAGCCGACCAGGCCGAGCAGCGCCGCCGCCAGCAGGCCGAGAGTGCGCGCGGCAGCCGG
CTGTTCGCCGGCGCCGGCGAGGGACGCGGTCCGCCCCAAGCAGCGAACGCCACGCCCACCGAACCTGCTC
CGGCGCCGCCGGCCGAGGGCACGTCACGAGCGGGCGCACCGCTCGACCGCCGCGCCGCGTTCGTCGCCGG
GGGAACGCCCGAGCCTACCACCAACAGCGGCCGCCTCACGCCTCCTCCCGGCCGCCATGTCGTGACCGCC
GGCTCGACGATCGCCGCGGCGCTGATCACCGGGCTTTCGTCCGACCTTGCGGGCCAGGTCGTCGCGCAGG
TGACCGAGGACGTATTCGATTCCGTGACCGGACGGACGAAGCTCATTCCGCAGGGAACGCGGCTGCTTGG
AGTCTATGATTCGAATGTCAGCACCGGCCAGTCCCGCGCGCTGGTCGTGTGGACGCGGATGATCCTGCCG
GACGGGCGCAGCATCGGTCTCGATCGCCTGGTTGGCACCGATGCGGCCGGTCAATCGGGATTTGCCGACC
GGGTCAACAATCACTGGGGCACGATTCTGCGCGCCGGTTTGCTTTCGACGCTACTCGGGGTCGGCACGCA
GGCGAGCGGGTTCGGCCAGAATGACGCAATCGCCGACGCGATCCGCGACAGTGCCGGCCAGACGGTTGGC
CGCGCCGGTGACCGGATCGTCGAGCGCCAGCTTGGAATACAGCCGACCATCAGCGTGCGCCCCGGTGCGC
GGGTTCGCGTACTCGTAAGCCGGGATTTGATATTGGAGCCGTGGCCGGGTCGCGACGCCGGCGGTTGA
 Primer design