SecReT4
Protein ID: 148553104
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0177
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]167308..169044 [-]
ProductType IV secretory pathway VirD4 components-like protein
Component typeTraG
UniProt IDA5V2N2
KEGG IDswi:Swit_0177
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.2e-120, Aligned region: 190..574
TraG-D_C [PF12696], Evalue: 1e-21, Aligned region: 430..556
T4SS-DNA_transf [PF02534], Evalue: 1.6e-15, Aligned region: 202..558
AAA_10 [PF12846], Evalue: 1.1e-10, Aligned region: 205..241
AAA_10 [PF12846], Evalue: 1.1e-10, Aligned region: 424..502
FtsK_SpoIIIE [PF01580], Evalue: 2.4e-05, Aligned region: 202..230
Protein Sequence: 578 a.a.     [Download]
>gi|148553104|ref|YP_001260686.1| Type IV secretory pathway VirD4 components-like protein [Sphingomonas wittichii RW1]
MARPDMSGAARAPGPTPGVQPIAFVGGLIAIWVCWPLVRMHIPAESQFALIDLVHEHWEHRAELQPWLDR
RWAWLALHNYHLWFAAAILPGTIAVGIVQGLDRRSFLPLLLAPFGWLGGGLVGYLLYGSFRGDSWPLAVM
MPATFAFLGGAVAARLAAPPRRVRHLRGTKMRPAVSAWRGRLWARLTGGLTLAGVPLSREDETMHVAAIG
ATGSGKSTALHGLMAGALRRGDRHIVADPEGAAMSAFFADGDILLDPFDARCARWDLLAEIESPSDYAFL
ASSLLPHLGTGDHDQWISYAQRLLADTMENFVTLELGSTSDYVALLGSARIAELKELCAGTSSARYFEEG
GERMLASILGTLAPAVAHLRLIAMASGEVFSLRRWIREGRGSLWMPYAANQVAAMRGLVSCWMNIAILET
LSLPASRDRRIWFHIDELDALGRIEGLKDAQARLRKVGGCVAIGFQSFAQVKHVYGEAAHTIVENCGNLL
ILRCGGGGDESTANLANELIGEREAERDDLSRSQSRGRNASQSTSVQSRRSVDPAVLASEIMQLPNREGF
VKRALDPRWQRVRFPFRA
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|148552929|ref|NC_009511.1|:c169044-167308 Sphingomonas wittichii RW1 chromosome, complete genome
ATGGCCCGGCCGGATATGAGCGGCGCGGCGCGCGCACCAGGGCCGACGCCCGGCGTCCAGCCGATCGCCT
TTGTTGGCGGACTCATCGCGATCTGGGTCTGCTGGCCGCTGGTGCGCATGCACATTCCGGCGGAAAGCCA
GTTCGCCTTGATCGACCTGGTGCACGAGCATTGGGAACATCGCGCCGAACTCCAGCCCTGGCTCGACCGG
CGCTGGGCGTGGCTCGCACTCCATAACTATCATCTGTGGTTCGCCGCCGCGATACTGCCCGGCACGATCG
CGGTCGGTATCGTCCAGGGCCTCGATCGCCGTTCCTTCTTGCCGCTCCTGCTCGCACCGTTTGGCTGGCT
CGGCGGCGGACTTGTCGGCTATTTACTCTACGGGAGCTTTCGCGGCGACAGCTGGCCGCTCGCGGTGATG
ATGCCGGCGACGTTCGCCTTCCTGGGCGGCGCCGTCGCGGCCCGGCTCGCGGCACCTCCGCGCCGCGTTC
GCCATCTGCGTGGTACGAAGATGCGTCCGGCGGTGAGCGCTTGGCGCGGACGATTATGGGCACGGCTGAC
CGGGGGGTTGACCTTGGCCGGGGTGCCGTTGAGCCGCGAGGACGAAACCATGCATGTCGCGGCGATCGGC
GCCACCGGCTCGGGCAAGTCGACTGCGCTTCACGGCCTCATGGCCGGCGCGCTGCGCCGCGGCGACCGCC
ATATCGTCGCCGACCCGGAAGGTGCCGCCATGTCCGCCTTCTTCGCGGACGGTGACATCCTACTCGATCC
GTTCGATGCTCGCTGCGCCCGCTGGGACCTGCTCGCCGAGATCGAATCTCCCAGCGACTATGCGTTTCTC
GCTAGCTCGCTGCTGCCGCATCTGGGCACCGGCGACCATGATCAATGGATCAGCTACGCCCAGCGCCTGC
TCGCCGACACGATGGAGAATTTCGTGACGCTCGAGCTCGGCAGCACGAGCGACTATGTCGCGCTGCTGGG
CAGCGCCCGGATCGCCGAGCTCAAGGAATTGTGCGCCGGAACGTCGTCGGCTCGCTATTTCGAGGAAGGC
GGCGAACGGATGCTCGCCAGCATTCTCGGCACGCTGGCACCGGCAGTCGCACACTTGAGGTTGATCGCCA
TGGCCAGTGGAGAGGTCTTCTCCCTGCGTCGCTGGATCCGTGAAGGCAGGGGCTCGCTCTGGATGCCCTA
TGCCGCGAACCAGGTCGCAGCGATGCGCGGCCTCGTCTCCTGCTGGATGAACATCGCCATCCTCGAGACC
CTCTCGCTTCCCGCCTCGCGCGATCGCCGTATCTGGTTCCACATCGATGAGCTCGACGCGCTCGGCCGGA
TCGAGGGTCTGAAGGACGCGCAGGCGCGGCTGCGCAAGGTCGGGGGCTGCGTCGCCATCGGGTTCCAGTC
ATTCGCCCAGGTCAAGCATGTCTATGGCGAAGCGGCCCATACTATCGTCGAGAATTGCGGGAATCTGCTT
ATCCTGCGCTGTGGCGGAGGCGGCGATGAAAGCACCGCCAATCTCGCGAACGAGTTGATCGGTGAGCGCG
AAGCCGAGCGAGATGATCTAAGCCGCTCGCAAAGCCGCGGGCGCAATGCTTCCCAATCCACTTCGGTGCA
GAGCCGGCGCTCTGTCGACCCCGCCGTCCTGGCCAGCGAGATCATGCAACTCCCCAATCGCGAGGGCTTT
GTGAAACGCGCGTTGGACCCGAGATGGCAGCGTGTGCGGTTTCCATTTCGCGCATGA
 Primer design