SecReT4
Protein ID: 148553108
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0181
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]172259..172963 [-]
Productlytic transglycosylase subunit
Component typeTrbN
UniProt IDA5V2N6
KEGG IDswi:Swit_0181
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 234 a.a.     [Download]
>gi|148553108|ref|YP_001260690.1| lytic transglycosylase subunit [Sphingomonas wittichii RW1]
MKTPAALALGVIAAVVSAAPADAQSASPRGASACAVHAPEAASRARLPVDVVLRVMRAESAGNPRAVSHK
GAMGCMQIMPGTWADLTRRHGLGRDPFDPRMNMIGGALYLAEMVARFGLPGAYSAYNAGPGRYQRHIAND
VPLPRETIAYTARVTGAAPSRGAVPAAPRWQDAGLFMAQSDVPRSSPARVGNDGDRTAHSRHDATAHSSG
VLFPLAGPVRDASEPGRAGIGTEP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|148552929|ref|NC_009511.1|:c172963-172259 Sphingomonas wittichii RW1 chromosome, complete genome
GTGAAGACGCCTGCCGCCCTGGCGCTTGGCGTCATTGCAGCGGTCGTTTCGGCCGCGCCTGCCGACGCGC
AATCCGCCTCGCCGCGCGGTGCCTCGGCCTGCGCCGTCCATGCGCCGGAGGCGGCAAGTCGCGCCCGGCT
GCCCGTCGATGTCGTACTGCGCGTCATGCGCGCCGAGAGCGCTGGCAACCCGCGTGCCGTCTCGCACAAA
GGCGCGATGGGCTGCATGCAGATCATGCCCGGAACCTGGGCCGATCTCACCCGGCGCCACGGACTTGGGC
GCGACCCGTTCGATCCGCGCATGAACATGATCGGCGGTGCGCTCTATCTCGCCGAGATGGTCGCGCGGTT
CGGATTGCCGGGCGCCTACTCGGCCTACAATGCCGGGCCGGGACGCTATCAGCGCCATATTGCGAACGAC
GTTCCGCTGCCCCGCGAGACCATCGCATACACCGCGCGCGTGACCGGCGCGGCGCCATCGCGAGGTGCCG
TTCCGGCCGCGCCACGATGGCAGGACGCGGGCCTGTTCATGGCGCAGTCCGACGTGCCACGATCGAGCCC
GGCGCGGGTCGGCAATGACGGCGATCGGACGGCACATTCGCGTCACGATGCGACCGCGCACTCCAGCGGT
GTGCTGTTTCCGCTCGCGGGGCCCGTGCGCGATGCGTCCGAGCCGGGGCGCGCCGGCATCGGGACCGAGC
CTTAG
 Primer design