SecReT4
Protein ID: 148553109
T4SS name [ID]Trb [294]
Gene symbol-
Locus tagSwit_0182
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]172960..173403 [-]
ProductType IV secretory pathway protease TraF-like protein
Component typeTraF
UniProt IDA5V2N7
KEGG IDswi:Swit_0182
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.9e-46, Aligned region: 8..145
Protein Sequence: 147 a.a.     [Download]
>gi|148553109|ref|YP_001260691.1| Type IV secretory pathway protease TraF-like protein [Sphingomonas wittichii RW1]
MHRPPLRLVWNVSPSVPVGLYRIDSAGDPRPGDLVALRPSPDLTRLMAERHYVEAGALLLKPIAAGAGAT
VCRNGAVVTIDGVSVATARERDRLGRPLPRWSGCRLLNASELFLLATESPDSFDGRYFGPAARSNVVGRA
MPLWTRP
 
Nucleotide Sequence: 444 bp     [Download]
>gi|148552929|ref|NC_009511.1|:c173403-172960 Sphingomonas wittichii RW1 chromosome, complete genome
ATGCATCGTCCGCCTCTGCGCCTGGTCTGGAACGTATCGCCGAGCGTGCCCGTCGGGCTCTATCGCATCG
ACTCCGCCGGCGATCCCCGCCCCGGCGACCTGGTCGCGTTGCGCCCATCGCCCGACCTCACCCGGTTGAT
GGCGGAGCGGCACTATGTCGAGGCCGGCGCACTCCTCCTCAAGCCGATCGCCGCGGGCGCGGGCGCGACC
GTGTGCCGGAATGGCGCGGTCGTTACGATCGACGGCGTCTCCGTCGCCACCGCGCGGGAACGCGACCGGC
TCGGCCGGCCGCTGCCGCGCTGGTCGGGCTGCCGCCTCCTGAACGCGAGCGAGCTGTTCCTGCTCGCGAC
GGAGAGCCCGGATTCATTTGACGGGCGCTATTTCGGGCCCGCCGCACGCTCGAATGTCGTCGGGCGCGCG
ATGCCGCTGTGGACTCGCCCGTGA
 Primer design