SecReT4
Protein ID: 148556594
T4SS name [ID]Trb [295]
Gene symbol-
Locus tagSwit_3692
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]4055962..4056297 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA5VCM2
KEGG IDswi:Swit_3692
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.9e-24, Aligned region: 9..100
Protein Sequence: 111 a.a.     [Download]
>gi|148556594|ref|YP_001264176.1| conjugal transfer protein TrbC [Sphingomonas wittichii RW1]
MIHALRHGARRAMLAATASVIALTISAPAHAGGSSMPWEAPLQSILESIEGPVAKIIAVIIIIVTGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGLVVA
 
Nucleotide Sequence: 336 bp     [Download]
>gi|148552929|ref|NC_009511.1|:4055962-4056297 Sphingomonas wittichii RW1 chromosome, complete genome
ATGATCCATGCCCTTCGGCATGGCGCACGCCGCGCCATGCTCGCCGCCACCGCCAGCGTCATCGCGCTGA
CCATCTCGGCACCCGCCCATGCGGGCGGATCGTCGATGCCGTGGGAAGCCCCGCTGCAATCCATCCTCGA
AAGCATCGAGGGGCCGGTCGCGAAAATCATCGCGGTCATCATCATCATCGTCACCGGCCTGACCCTGGCG
TTCGGCGACACCTCGGGCGGCTTTCGCCGGCTGATCCAGATCGTCTTCGGCCTGTCGATCGCCTTCGCCG
CGTCGAGCTTCTTCCTGTCGTTCTTCTCGTTCGGCGGGGGGCTCGTCGTCGCATGA
 Primer design