SecReT4
Protein ID: 148556599
T4SS name [ID]Trb [295]
Gene symbol-
Locus tagSwit_3697
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]4060055..4061440 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5VCM7
KEGG IDswi:Swit_3697
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.6e-49, Aligned region: 37..262
Protein Sequence: 461 a.a.     [Download]
>gi|148556599|ref|YP_001264181.1| conjugal transfer protein TrbL [Sphingomonas wittichii RW1]
MNDTGVIDNFLNVFTGYIDSGFGLLGGEVAFLSTTLIAIDVTLAGLFWAWGADEDVLQRLVKKTLYIGTF
AFIIGNFSLLATIVFESFAGLGLQASGGAMTIDEFMKPGTIAAKGLEAAKPLLDAAGQFSSLWAVFSNLA
LILVLLLAWVIVVLAFFIIAVQVFITLIEFKLVTLAGFVLLPFAFFNKTAFMAEKVLGHVVSTGIKVLVL
AVITGIGTTLFSQFTGAALGPAPDINQVMAIALAALSLLGLSIFGPGIANGIVSGGPQLGAGAAAGTALA
AGGALVGGAAAARLGVGTAGSALGAAGRMTGAAARGGAQMAGGATSAYSLGSFGKSGAGAVAGGMAAVGQ
AAAGSAASAVLSPLRAAAVKGGAAMKSNFRSGARAGFTATGGTITGGPAPAAPAAAPAGGSASAGSSAQP
EWAAAMKRREAVSHGATVLAHTMKAGDSHGGGAGPDIKEKD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|148552929|ref|NC_009511.1|:4060055-4061440 Sphingomonas wittichii RW1 chromosome, complete genome
ATGAACGACACCGGCGTTATCGACAATTTCCTCAACGTCTTCACCGGCTACATCGACTCAGGCTTCGGCC
TGCTCGGCGGCGAGGTCGCGTTCCTCTCGACAACGCTGATCGCCATCGACGTGACGCTCGCCGGTCTGTT
CTGGGCCTGGGGCGCGGACGAGGACGTGCTTCAGCGCCTCGTCAAGAAAACGCTCTACATCGGCACCTTC
GCTTTCATCATCGGCAATTTCTCGCTGCTCGCGACCATCGTGTTCGAGAGCTTCGCCGGGCTCGGCCTCC
AGGCCAGCGGCGGGGCGATGACGATCGACGAGTTCATGAAGCCCGGCACGATCGCGGCGAAGGGGCTCGA
AGCCGCCAAGCCGCTGCTCGATGCGGCGGGGCAGTTCTCCAGCCTTTGGGCCGTGTTCTCGAACCTCGCG
CTGATCCTCGTGCTGCTGCTCGCCTGGGTGATCGTGGTGCTCGCCTTCTTCATCATCGCCGTGCAGGTCT
TCATCACGCTGATCGAGTTCAAGCTGGTGACGCTCGCCGGCTTCGTCCTGCTGCCCTTCGCCTTCTTCAA
CAAGACCGCCTTCATGGCCGAGAAGGTGCTGGGCCATGTCGTCTCGACCGGCATCAAGGTGCTGGTGCTC
GCCGTCATCACCGGCATCGGCACCACGCTGTTCAGCCAGTTCACCGGGGCGGCTCTCGGCCCCGCGCCCG
ACATCAATCAGGTCATGGCCATCGCGCTCGCCGCGCTGTCGCTGCTGGGCCTGTCGATCTTCGGACCCGG
CATTGCGAACGGCATCGTCTCGGGCGGGCCGCAGCTCGGCGCGGGTGCGGCGGCCGGGACCGCGCTGGCC
GCAGGCGGCGCGCTGGTCGGTGGCGCGGCCGCCGCACGGCTTGGCGTCGGGACCGCCGGTTCCGCCCTCG
GCGCGGCCGGCCGGATGACCGGCGCCGCCGCGCGGGGCGGCGCTCAGATGGCTGGCGGCGCGACCAGCGC
CTACAGCCTCGGCTCGTTCGGCAAGAGCGGCGCGGGCGCTGTCGCGGGCGGCATGGCCGCGGTCGGCCAG
GCGGCGGCGGGCAGCGCGGCGAGCGCCGTCCTTTCGCCGCTGCGCGCGGCGGCCGTCAAGGGCGGCGCGG
CGATGAAGTCCAACTTCCGCTCCGGCGCCCGCGCCGGGTTCACCGCCACCGGCGGCACGATCACCGGCGG
ACCCGCGCCCGCCGCCCCGGCGGCCGCGCCCGCTGGCGGTTCCGCATCGGCGGGCTCGTCGGCCCAGCCT
GAATGGGCCGCCGCGATGAAACGTCGCGAGGCCGTCAGCCACGGCGCGACCGTCCTCGCCCACACCATGA
AGGCTGGCGACAGCCACGGCGGCGGCGCCGGTCCCGACATCAAAGAGAAGGACTGA
 Primer design