SecReT4
Protein ID: 148556601
T4SS name [ID]Trb [295]
Gene symbol-
Locus tagSwit_3699
StrainSphingomonas wittichii RW1
Repliconchromosome [GenBank: NC_009511] [Browse all T4SS(s) in this replicon]
Location [Strand]4062127..4063143 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDA5VCM9
KEGG IDswi:Swit_3699
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-68, Aligned region: 107..330
Protein Sequence: 338 a.a.     [Download]
>gi|148556601|ref|YP_001264183.1| P-type conjugative transfer protein TrbG [Sphingomonas wittichii RW1]
MTHTPFRRSASAVLLVSATALAGCATTSAKPPAIRYDDPPREIAATPAAEPLRAVEVVTIPEPLPFPGQL
KPVAAGAATAEHADPRRRVGAANAAARVQPVRDGFLNAIQQYPWTDGALYQVYAAPGQVTDIALQEGEKL
VGPGPVAAGDTVRWIIGDTVSGGGATARVHILVKPTRPDLSTNLVINTDRRTYHLELRATASTYMASVSW
TYPQDQLIALRSANTAAAASAPVATGLDLAALNFRYRIEGDRVPWKPVRAFDDAAQVFIEFPAGISQGEM
PPLFVTGAAGDAELVNYRVQGRYMVVDRLFAAAELRLGDRRSEQRIRIVRDDGRRGRP
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|148552929|ref|NC_009511.1|:4062127-4063143 Sphingomonas wittichii RW1 chromosome, complete genome
ATGACGCACACGCCATTTCGCCGTTCCGCCTCGGCGGTCCTGCTTGTCTCCGCCACCGCGCTCGCCGGCT
GCGCCACCACATCGGCGAAGCCGCCCGCGATTCGCTATGACGACCCGCCGCGCGAGATCGCGGCGACGCC
GGCCGCGGAACCACTCCGCGCCGTCGAGGTGGTGACGATCCCCGAACCCCTGCCGTTCCCCGGCCAATTG
AAGCCGGTCGCGGCCGGGGCGGCGACTGCCGAGCACGCCGATCCACGCAGGCGCGTCGGGGCCGCCAACG
CCGCCGCCCGCGTGCAGCCGGTGCGTGACGGTTTCCTCAACGCCATCCAGCAATATCCCTGGACCGACGG
AGCGCTCTATCAGGTCTATGCCGCGCCCGGCCAGGTGACGGACATCGCATTGCAGGAAGGCGAGAAGCTC
GTGGGGCCGGGGCCGGTCGCGGCCGGCGACACCGTGCGCTGGATCATCGGCGACACGGTGAGCGGCGGCG
GCGCGACGGCCCGCGTGCATATCCTCGTGAAGCCCACGCGGCCCGACCTTTCCACGAACCTCGTCATCAA
CACCGACAGGCGGACCTATCATCTGGAGCTGCGCGCGACGGCTTCGACCTACATGGCGTCGGTCTCGTGG
ACCTATCCGCAGGACCAGCTCATCGCGCTGCGCAGCGCCAATACCGCAGCCGCCGCCTCGGCCCCCGTCG
CGACCGGCCTCGACCTCGCGGCGCTCAATTTCCGCTACCGGATCGAGGGCGACCGCGTGCCGTGGAAGCC
GGTGCGCGCTTTCGACGATGCCGCCCAGGTGTTCATCGAGTTTCCGGCCGGGATCTCGCAGGGCGAGATG
CCGCCGCTATTCGTGACCGGCGCGGCCGGTGATGCCGAGCTGGTCAATTACCGCGTGCAGGGCCGCTACA
TGGTGGTGGACCGGCTGTTCGCCGCCGCCGAGCTGCGCCTGGGCGACCGGCGCAGCGAGCAGCGCATCCG
CATCGTGCGCGACGACGGACGCAGGGGGCGGCCGTGA
 Primer design