SecReT4
Protein ID: 148557830
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0055
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]57613..58755 [-]
Producttype IV secretion system protein VirB10
Component typeVirB10
UniProt IDQ0GK35
KEGG IDbov:BOV_A0055
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 9.6e-62, Aligned region: 193..371
Protein Sequence: 380 a.a.     [Download]
>gi|148557830|ref|YP_001257136.1| type IV secretion system protein VirB10 [Brucella ovis ATCC 25840]
MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAENNHHSDKTMVQ
TSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKS
SGDTNAQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDS
TVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPL
GGAGLPGYIDSHFWKRFGGALMLSTIETFGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIP
PTLYKNQGEEIGIYIARDLDFSSVYDVKPK
 
Nucleotide Sequence: 1143 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c58755-57613 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGACACAGGAAAACATTCCGGTGCAGCCGGGCACACTTGACGGTGAGCGTGGCCTACCCACCGTGAACG
AAAACGGCTCCGGCCGCACCCGCAAGGTGTTGCTCTTTCTCTTTGTCGTGGGCTTCATCGTCGTGCTGCT
GTTGCTGCTCGTGTTTCACATGAGGGGCAATGCAGAGAATAATCACCATTCAGACAAGACGATGGTGCAG
ACCAGCACAGTTCCGATGCGAACTTTCAAGCTGCCACCCCCGCCACCACCAGCACCACCAGAACCACCAG
CCCCGCCACCGGCCCCAGCCATGCCCATCGCGGAACCCGCAGCGGCGGCGCTGAGCCTGCCACCATTGCC
GGATGATACGCCGGCAAAGGACGATGTACTGGACAAGTCGGCCAGCGCGTTGATGGTCGTCACCAAGTCC
AGCGGCGATACGAACGCTCAAACGACCAATGCGCGCATTCAAGCCCTGCTCGACAGTCAAAAGAACACCA
AGCAGGATGCTGGATCGCTGGGTACTCTCCTTCACGGCACACAAACGGATGCACGCATGGCGAGCCTTCT
GCGCAACCGTGATTTCCTGCTCGCGAAGGGCAGCATCATCAATTGCGCGCTGCAAACCCGTCTGGATTCG
ACGGTGCCGGGCATGGCTGCCTGCGTGGTCACACGCAACATGTATAGCGATAACGGCAAGGTGTTGCTGA
TTGAGCGCGGTTCAACCATCTCGGGTGAATATGATGCCAACGTAAAGCAGGGCATGGCTCGCATTTATGT
CCTGTGGACGCGCGTGAAGACGCCGAACGGTGTCGTGATCGATCTCGACTCTCCAGGCGCCGACCCCCTG
GGCGGGGCAGGCTTGCCCGGCTACATCGACTCCCACTTCTGGAAGCGCTTTGGCGGCGCCTTGATGTTGA
GCACGATCGAGACCTTCGGCCGCTATGCAACCCAGAAGGTCGGCGGCGGGGGTTCAAATCAGATCAACCT
CAATACCGGCGGAGGTGAATCGACGAGCAACCTGGCTTCAACTGCCTTGAAGGATACGATCAACATTCCG
CCGACACTGTACAAGAACCAGGGCGAAGAGATCGGCATCTATATCGCCCGCGACCTAGATTTTTCGAGTG
TGTATGATGTCAAACCGAAGTGA
 Primer design