SecReT4
Protein ID: 148557907
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0061
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]65120..65506 [-]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDA5VTI7
KEGG IDbov:BOV_A0061
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.3e-29, Aligned region: 22..114
Protein Sequence: 128 a.a.     [Download]
>gi|148557907|ref|YP_001257142.1| type IV secretion system protein VirB3 [Brucella ovis ATCC 25840]
MPLTCLGKGTQIMTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILP
LIVPIVLVMRQITQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES
 
Nucleotide Sequence: 387 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c65506-65120 Brucella ovis ATCC 25840 chromosome II, complete sequence
TTGCCTCTTACCTGCTTAGGTAAAGGGACACAGATCATGACAACGGCACCACAGGAATCCAACGCACGAA
GCGCAGGTTATCGCGGCGATCCAATATTCAAGGGCTGTACACGGCCAGCCATGTTGTTTGGGGTTCCTGT
GATCCCGCTTGTCATCGTTGGCGGCAGCATCGTTCTCTTATCGGTCTGGATTTCCATGTTCATATTGCCG
CTGATCGTACCAATCGTGCTGGTCATGCGGCAGATCACGCAGACTGACGATCAGATGTTCCGCCTGCTCG
GCCTGAAGGCGCAATTCCGCCTGATCCACTTCAACCGCACCGGGCGCTTCTGGCGGGCATCCGCCTATAG
CCCGATTGCCTTCACAAAGCGCAAAAGAGAATCATGA
 Primer design