SecReT4
Protein ID: 148558015
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0063
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]66237..66953 [-]
Producttype IV secretion system protein VirB1
Component typeVirB1
UniProt IDA5VTI9
KEGG IDbov:BOV_A0063
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.7e-20, Aligned region: 5..136
Protein Sequence: 238 a.a.     [Download]
>gi|148558015|ref|YP_001257144.1| type IV secretion system protein VirB1 [Brucella ovis ATCC 25840]
MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVRQPVSLDEAITTAQSLEAKGWNFSLGI
AQVNRYNLPKYGSTYAQAFDPCKNLKMGSKILEDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTK
PGSPSYVQKVVASADVTTKPIAVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGAAN
APVRLKTEQPATTDAPPGKDNTDGVVVF
 
Nucleotide Sequence: 717 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c66953-66237 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGGTGCCATTCCTTGTCCTCGCGCAACAATGCGCACCGACTGTTGCACCTCAGACTATGGCAGCAATCG
TGCAGGTCGAGTCGGGCTTCAATCCTTATGCAATAGGCGTCGTTGGTGGGCGGTTGGTCCGTCAACCCGT
TTCCCTTGATGAAGCAATCACGACAGCACAGTCACTGGAAGCCAAAGGCTGGAATTTCTCTTTGGGTATT
GCTCAAGTCAACAGGTACAATCTGCCGAAATATGGCAGCACCTACGCACAAGCGTTCGACCCCTGCAAGA
ACCTGAAGATGGGATCCAAGATCCTTGAAGACTGCTACCGTCGGGCCATCGTGAAGATGCCCGGTCAGGA
ACAAGGCGCGCTTCGCGCCGCATTCTCCTGTTACTACGCCGGCAACTTTACGGGCGGCTTCAAGACGAAG
CCCGGCAGTCCCAGCTACGTGCAGAAGGTCGTGGCAAGCGCCGACGTGACCACAAAGCCGATTGCTGTCG
TGCCCATGATCCGGAAAACGCCGGATGCGGCGGCAGCAGTAGCTGCCCCAGTAAAAAAACGACAGCCGGC
TGATCGTAATTCTGTTCTTGTCGATCTGCATCCATCATCGCAGTCGATGCCAGCCACCGGCGCGGCGAAC
GCGCCTGTAAGGCTGAAGACAGAGCAGCCGGCGACAACCGATGCGCCGCCAGGGAAGGATAATACGGACG
GCGTAGTTGTTTTCTAA
 Primer design