SecReT4
Protein ID: 148558165
T4SS name [ID]VirB [371]
Gene symbolvirB11
Locus tagBOV_A0054
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]56544..57632 [-]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDA5VTI0
KEGG IDbov:BOV_A0054
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-66, Aligned region: 26..328
Protein Sequence: 362 a.a.     [Download]
>gi|148558165|ref|YP_001257135.1| P-type DNA transfer ATPase VirB11 [Brucella ovis ATCC 25840]
MMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHL
ISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKH
VRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIED
VPELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHGGS
ITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTK
RALSLQHSEKTQ
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c57632-56544 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCCGTCAAACGGGCGGCCTCGGTCAATT
TCCATCTGGAACCGCTGCGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCGGCCGGG
CGAAGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAACACCTG
ATTTCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGCTGTCTG
CGATCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCATCTCGGT
GACGATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTCAAACAC
GTCAGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTGGTGATT
ACATGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGGATCAGG
CAAGACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATCGAGGAC
GTACCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGAAGGAAG
AAGAAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCGCATCCT
GCTTGCCGAGCTGCGCGGCGGCGAGACTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGCGGCAGC
ATCACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGCAGAACC
GCCAGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGTCGTGCA
CGTCCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAATACAAAA
CGGGCACTGTCACTGCAACACAGTGAGAAGACGCAATGA
 Primer design