SecReT4
Protein ID: 148558211
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0060
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]62625..65120 [-]
Producttype IV secretion system protein VirB4
Component typeVirB4
UniProt IDA5VTI6
KEGG IDbov:BOV_A0060
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.4e-72, Aligned region: 184..388
AAA_10 [PF12846], Evalue: 7.6e-24, Aligned region: 452..744
Protein Sequence: 831 a.a.     [Download]
>gi|148558211|ref|YP_001257141.1| type IV secretion system protein VirB4 [Brucella ovis ATCC 25840]
MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFR
AIASNNVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFN
VAVHRSHAEILQEQQLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSG
EWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYASHTEPGILNGLMYSDHEYVITQ
SFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNT
SHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQAL
TLLKTPSGQPAYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFF
DKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAI
RTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQIDFNTHSN
YGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFSEFANNKQLTIRKQNGLGV
FATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHS
MICRLELNGFDDELAILSGSLDNNELLDQVIAEVGDDPSVWLPVFQERRKARIASSKSTGR
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c65120-62625 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGGGCGCTCAATCCAAATACGCGCAACAGCTCAATAATGAACGGTCACTTGCACCGTTCATTCCCTTCA
GGAGCCAGGTTGGCCCGACCACCGTGATAACGCGTGACGGTGATTTCGTGCGCACATGGCGCATCGCGGG
CCTGGCTTTCGAGACGCAGGACAAGGAGAAACTGTTGATCCGCAAGGACCAGCTTAACACCTTGTTCCGT
GCCATCGCCTCAAACAATGTGGCGCTGTGGTCCCACAACGTACGGCGCAGAACCTGGGATCACTTGAAAT
CCTTCTTTTCCAATCCGTTCTGCGACGCTCTCGACAAGAAGTATTACGGATCGTTTTCCGGCTACCGAAT
GATGTCAAACGAACTGTATCTGACGGTTATTTACCGGCCAGTGCCGGCGAAGATCAGCAGGTTGTTCAAC
GTGGCCGTTCATCGTTCGCATGCGGAAATCTTACAGGAGCAGCAGCTTGCCATCCGCAAGCTGGACGAAA
TCGGCAATCAAATTGAAACCAGCTTGCGTCGCTACGGTGGCGATGACGGGCGTGGCATCGAAGTGCTGAG
CACCTATGAGGACAAACACGGCGCACTGTGCTCACAGCAGCTTGAATTTTATAACTTCCTTCTCTCAGGC
GAATGGCAGAAGGTGCGCGTGCCATCCTGCCCACTAGATGAATATCTGGGCACCGGGTGGGTGTATGCTG
GCACTGAAACCATCGAGATACGCACCGCGAACGCGACGCGCTATGCGCGTGGCATCGATTTCAAGGACTA
TGCGAGCCACACCGAGCCGGGCATTTTGAACGGCCTGATGTATAGCGATCACGAGTACGTCATCACACAA
TCCTTCAGCTTCATGACAAAGCGGGATGGCAAGGAGTTCCTGACACGGCAAAAGCAGCGGCTCCAAAATA
CCGAAGACGGCAGCGCATCCCAGATCATGGAAATGGACATTGCCATCGACCAGCTCGGCCGGGGCGATTT
CGTCATGGGTGAATATCATTATTCGCTGCTGGTATTTGCCGAAGACATGGAGACGGTGCGCCACAACACA
TCACATGCGATGAACATCCTGCAAGACAATGGTTTTCTGGCGACGGTGATCGCCACGGCCACGGATGCGG
CGTTCTATGCACAACTGCCATGTAACTGGCGGTATCGGCCGCGCGTGGCGGGCCTGACCTCGCTCAACTT
CGCCGGTCTGTCATGTTTCCATAATTTCCGCGCAGGCAAGCGGGATGGCAACCCCTGGGGGCAGGCATTG
ACGCTGCTCAAAACCCCTTCCGGACAGCCCGCCTACCTGAACTTCCACTATTCAAAAGGCGACGAAGACA
ACTTCGACAAGAAGCTTCTGGGCAATACCCGCATCATCGGCCAGTCCGGCGCTGGTAAAACTGTCCTGAT
GAACTTCTGCCTCGCGCAAGCGCAGAAGTATTTGCACAATGCTCCGATGGGTATGTGCAACGTCTTTTTC
GACAAGGATCAAGGCGCGAAAGGGACTATTCTTGCCATTGGCGGCAAATACCTTGCCATCAGGAACGGCG
AACCCACCGGGTTCAACCCATTCCAGATGGAGCCAACAGCGGGGAACATCCTGTTCCTTGAAAAACTCGT
ACAGGTACTGGTATCGCGTGATGGCCAGCACGTGACCACAACGGACGAAAGCCGGATCAGTCATGCCATA
CGTACGGTCATGCGCATGCGCCCGGAGCTGCGGCGTCTGTCGACGGTGCTGCAAAACGTTACCGAAGGCA
GCGACCGCCAAGATCGTGAAAACAGCGTGGCGAAGCGGCTCGCGAAGTGGTGTTTTGATGACGGCACCGG
CAAGCGGGGCACATTCTGGTGGGTGCTGGATTGCCCGCAAGACCAGATCGACTTCAACACGCATAGCAAT
TACGGTTTCGATGGCACCGACTTCCTCGACAACGCCGACGTGCGTACGCCGATTTCCATGTACCTGCTGC
ATCGTATGGAATTGGCTATCGACGGGCGTCGTTTCATCTACTGGATGGACGAGGCGTGGAAGTGGGTAGA
CGACGAAGCATTCAGCGAGTTCGCCAATAACAAGCAGCTTACCATCCGCAAGCAAAACGGCCTGGGCGTG
TTTGCCACGCAAATGCCCTCCAGCCTGCTCAACTCCAAAGTCGCGTCGGCCCTGGTGCAACAGGTGGCGA
CGGAAATCTATCTGCCGAATCCGAAAGCCGATTATCACGAGTACACGGACGGCTTCAAGGTGACGAACGA
GGAGTTCGACATCATCCGCAGTATGAGCGAGGAAAGCCGCATGTTCCTGGTCAAGCAGGGGCATCATTCG
ATGATTTGCCGCCTGGAGCTTAATGGCTTTGATGACGAACTGGCGATCCTCTCAGGCAGCTTGGACAACA
ACGAGTTGCTGGACCAGGTCATTGCCGAAGTCGGGGACGACCCTTCGGTATGGCTTCCGGTGTTCCAGGA
GCGCCGGAAAGCACGCATTGCGTCGTCCAAATCAACAGGAAGGTGA
 Primer design