SecReT4
Protein ID: 148558277
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0062
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]65484..65801 [-]
Producttype IV secretion system protein VirB2
Component typeVirB2
UniProt IDA5VTI8
KEGG IDbov:BOV_A0062
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.5e-21, Aligned region: 7..103
Protein Sequence: 105 a.a.     [Download]
>gi|148558277|ref|YP_001257143.1| type IV secretion system protein VirB2 [Brucella ovis ATCC 25840]
MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSG
YKMAFRHARFMDVVPVLGGALVVGAAAEIASYLLR
 
Nucleotide Sequence: 318 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c65801-65484 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGAAAACCGCTTCCCCCAGCAAGAAGTCGCTGTCGCGGATTCTACCTCACCTACTGCTGGCCCTCATTG
TCTCCATCGCTGCAATCGAGCCTAACCTGGCGCACGCCAACGGTGGCCTCGATAAGGTAAATACAAGCAT
GCAAAAAGTGCTGGACTTGCTAAGCGGCGTATCGATCACCATCGTTACCATAGCCATCATCTGGTCCGGT
TACAAGATGGCATTCCGGCACGCCCGCTTCATGGATGTAGTGCCGGTGCTGGGCGGCGCCCTGGTGGTTG
GCGCTGCCGCCGAAATTGCCTCTTACCTGCTTAGGTAA
 Primer design