SecReT4
Protein ID: 148558296
T4SS name [ID]VirB [371]
Gene symbol-
Locus tagBOV_A0057
StrainBrucella ovis ATCC 25840
Repliconchromosome II [GenBank: NC_009504] [Browse all T4SS(s) in this replicon]
Location [Strand]59618..60337 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDA5VTI3
KEGG IDbov:BOV_A0057
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.1e-64, Aligned region: 26..234
Protein Sequence: 239 a.a.     [Download]
>gi|148558296|ref|YP_001257138.1| type IV secretion system protein VirB8 [Brucella ovis ATCC 25840]
MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLIEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQ
HVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQS
YASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPS
LMSESARLTNPLGFNVTSYRVDPEMGVVQ
 
Nucleotide Sequence: 720 bp     [Download]
>gi|148557829|ref|NC_009504.1|:c60337-59618 Brucella ovis ATCC 25840 chromosome II, complete sequence
ATGTTTGGACGCAAACAATCTCCACAGAAATCAGTAAAGAACGGGCAGGGCAATGCGCCTTCGGTATATG
ACGAAGCGTTGAACTGGGAGGCCGCGCACGTCCGGCTGATCGAAAAATCCGAACGCCGCGCGTGGAAAAT
CGCCGGGGCTTTCGGCACCATTACCGTGCTGCTCGGGATCGGCATCGCCGGGATGTTACCGCTAAAGCAA
CATGTGCCCTACCTGGTGCGCGTCAACGCACAGACAGGTGCGCCTGATATCCTGACCTCGCTCGACGAGA
AGAGTGTCAGCTACGACACTGTAATGGATAAATACTGGCTCTCGCAGTACGTGATAGCGCGTGAAACCTA
CGACTGGTACACGCTGCAAAAGGACTACGAAACCGTAGGCATGTTGTCGTCGCCGTCCGAAGGGCAGAGC
TATGCAAGCCAGTTCCAGGGCGATAAGGCGCTTGACAAGCAATATGGCTCAAATGTGCGCACATCGGTAA
CGATCGTAAGCATCGTGCCGAACGGCAAGGGCATCGGCACGGTGCGCTTTGCGAAGACGACAAAGCGCAC
CAACGAGACCGGTGACGGCGAAACAACGCACTGGATCGCCACCATTGGCTACCAATACGTCAATCCCTCT
TTGATGTCGGAATCGGCCCGCCTGACAAACCCGCTGGGTTTCAATGTCACGAGCTATCGCGTTGATCCAG
AAATGGGAGTGGTGCAATGA
 Primer design